KEGG   Streptococcus oralis: SOR_1447Help
Entry
SOR_1447          CDS       T01476                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sor  Streptococcus oralis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SOR_1447
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SOR_1447
Enzymes [BR:sor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SOR_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398975..1400318
Genome map
AA seq 447 aa AA seqDB search
MKLKTTLGLLAGRSSHFILSRLGRGSTLPGKLALQFDKDILQNLAKNYEIVVVTGTNGKT
LTTALTVGILKEVYGQVLTNPSGANMITGITTTFLTAKSSKTGKNIAVLEIDEASLSRIC
DYIHPSLFVITNIFRDQMDRYGEIYTTYNMILDAIRKVPTATVLLNGDSPLFYKPAIPNP
VQYFGLDLEKGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGAYICENCGCKRPDLDYR
LTELVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARFLGADSQRIKQGFDKSRA
VFGRQETFHIGNKECTLVLIKNPVGATQAIEMIKLAPYPFSLSVLLNANYADGIDTSWIW
DADFEQITDMDIPAINAGGVRHSEIARRLRVTGYPADKITETSNLEQVLKTIENQDCKHA
YILATYTAMLEFRELLASRQIVRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaactactttgggtctcctagctgggcgttcttctcattttattttgagc
cgtcttggccgtggaagtacgctccctggaaaactcgcccttcaatttgataaagatatt
ttacaaaacctagctaagaactacgagattgtcgtggtcactggaaccaacgggaaaacc
ctgacaactgctctcactgtcggtattttaaaagaagtttatggtcaagttctgaccaat
ccaagcggtgccaatatgattacagggattacgacaaccttcttgacggccaaatcctct
aaaactgggaaaaacattgccgttctagaaattgacgaggccagtctatctcgtatctgt
gactacatccatcctagcctttttgtcatcactaatattttccgtgatcagatggaccgc
tacggtgagatttacacaacttataacatgattttggatgccatccgtaaggtgcctacg
gctactgttctcctcaatggtgacagtccgcttttctataaaccagctattccaaaccca
gttcagtattttggtttagacttggagaaagggccagcccaactggctcactacaatacc
gaagggattctctgccctgactgtcaaggcatcctcaaatatgagcacaatacctatgcc
aacttgggtgcctatatctgcgaaaattgtggctgcaaacgacctgacttggactaccgt
ctgacagaactagttgagttgaccaacaatcgctctcgttttgtcattgacggacaagaa
tacggcatccaaatcggtggactttacaacatctacaatgcccttgctgcggttgccatt
gctcgcttcctcggtgcagattcacaacggatcaaacaaggatttgacaagagtcgtgca
gtctttggtcgtcaggaaaccttccatatcggtaacaaagaatgtacccttgtcctcatc
aagaatccggttggtgcaactcaggctatcgagatgattaaactagcgccttatccattt
agcctttctgtcctcctcaatgccaactatgctgatgggattgataccagttggatctgg
gatgcagactttgaacaaatcactgacatggatatccctgcaatcaatgctggcggtgtt
cgtcattctgaaatcgcacgccgtcttcgagtgactggctacccagctgataaaatcact
gagacaagcaatctggagcaagttctcaaaaccattgagaaccaagactgcaagcatgcc
tatatcctggctacctatactgctatgctagaattccgtgaactgctggctagtcgtcag
attgttagaaaggagatgaactaa

DBGET integrated database retrieval system