KEGG   Streptococcus oralis: SOR_1458Help
Entry
SOR_1458          CDS       T01476                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sor  Streptococcus oralis
Pathway
sor00010  Glycolysis / Gluconeogenesis
sor00051  Fructose and mannose metabolism
sor00562  Inositol phosphate metabolism
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01130  Biosynthesis of antibiotics
sor01200  Carbon metabolism
sor01230  Biosynthesis of amino acids
Module
sor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sor_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_1458
   00051 Fructose and mannose metabolism
    SOR_1458
   00562 Inositol phosphate metabolism
    SOR_1458
Enzymes [BR:sor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SOR_1458
Exosome [BR:sor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SOR_1458
  Exosomal proteins of bladder cancer cells
   SOR_1458
  Exosomal proteins of melanoma cells
   SOR_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBZ01110
UniProt: F2QEP1
Position
complement(1408476..1409234)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPAVDLTAVLAAAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcattcgttgaagccgttgcatcaaaacttccttcatcagaccttgttgaagcaggt
atcgcagctcctgcagttgatttgacagctgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagagcgtcgt
gactacttccatgaaactgacgaagatatcaataaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgcccaagtatctgctgcattggctggattgacagctgaacaagtt
gctgcatcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagcagctgactttggt
caagaagttgcggacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgttggtggtgcgtcacttgaa
gctgaaagcttcttggcattgcttgattttgtaaaataa

DBGET integrated database retrieval system