KEGG   Streptococcus oralis: SOR_1622Help
Entry
SOR_1622          CDS       T01476                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sor  Streptococcus oralis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SOR_1622
Enzymes [BR:sor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SOR_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1575665..1578031
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLDIEDTNAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYERAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDSYGDNTIDEIL
EHPEKLEGISGLSAKNREAFLSTLRLNYGTEMVLAKLANYGIPNKLAFQIQDFYKDETLD
IVENYPYQLVEDIKGLGFTIADQLAAELGIESQAPERFRAGLVHSLFQGCMDTGDTYMEA
RDLLEQTLTLLESSRPVELDPSQVAQELSHLIEEDKVQQIDTKIFDNSLFFAEEGIHSHL
VRILEKGKQKSQDLETIHKHIATVEQELGIQYDDIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDLKKKSNLPILLAAPTGRAARRMNELTGLSSATIHRHLGMTGDD
DTSHLDDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLQIPLIPQTRLERIYRQSEESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGVALRSGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQYFYR
KGGKVIHLVNDAEVNVFNGDLGYITDLIPGKYTESKQDEIVIDFDGNEVIYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASKRMLERNLIYTAITRAKSKLILLGELQAFDYAVK
HIGTARKTYLIERFKDLVEATDQTSPAPSETTNQEDSPLSYILTEENWSSIHAMIGITDV
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggcaccattgaacgcattatttttgaaaatcccagtaatttt
tatcgtattctcctcctagatatcgaagataccaatgcggaggactttgacgattttgaa
atcatcgttacaggaaccatggctgacgtgattgagggcgaagactatactttttggggg
caaatcgttcagcactccaagtatggagaacagctacagatcagtcgttatgagagagca
aaacccactagtaagggtctagtcaagtacttttctagcagccatttcaagggaattgga
ctcaagactgcccagaaaatcgttgatagctacggtgacaataccatagacgaaattctg
gagcatcctgaaaagctggaaggcatctcaggactctctgccaaaaaccgtgaggctttt
ctttccaccctccgtctcaactatgggacagagatggttttggcaaaactagccaactac
ggcattcccaataaactagcctttcagattcaagacttttacaaggacgaaacgctggat
attgtcgaaaattatccctaccagctggttgaggatatcaagggcttgggctttaccatt
gctgaccaactagcagccgaactaggtatcgaaagccaagctcccgagcgcttccgcgct
ggccttgtccacagtctctttcaaggctgtatggatacgggcgatacctatatggaagcc
cgagatttgctggaacaaaccctgactctcctcgaatcttcccgtcccgtggaactcgat
cccagccaagtcgctcaggaattatctcatctaattgaagaggacaaggttcagcagatt
gataccaaaatctttgataatagcctctttttcgctgaagaaggcatccacagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagccaagatctagaaaccattcacaagcat
atcgctactgtcgagcaagaactggggattcagtacgatgacattcaaaagcaggctatc
tgcgatgccatccagaacaaggtctttatcctaacaggtggacctggtactggtaagaca
actgttatcaatggtatcatcgctgtctatgccctgcttgaaggactcgatctcaaaaaa
aagagcaacctccctattcttctcgctgcaccaactggtcgagccgctcggcgcatgaat
gaattgacaggattgtcaagtgctactatacatcgccatttggggatgacgggagacgat
gataccagtcatctagatgattatctggatgccgattttatcattgtagatgagttttcc
atggtggatacttggctagccaaccagctcttctccaatatctcctcaaacagtaaaatc
ctcatcgtgggagacagtgaccagttgccttctgtcagtcctggacaagtcctggctgac
ctgctccagatacccctgattccccagactcgcttggaacggatttaccgtcagagcgaa
gaatcaaccatcgttaccttggcaagtcagattcgacaaggcatcctgccagctgacttt
acccagaaaaaagcagaccgctcctactttgaaatcgctagtggccatatcccagctacc
attgagaaaattcttggtgtcgcactcagaagtggcattccggctcgcgatattcaggtg
ctggcgcctatgtatcgaggaactgctggtattgacgccatcaaccaactcatgcaagac
ctgctcaatccaccacaaaaagaccaactcagttttgaagctccccaatacttctatcgc
aagggtggcaaggtcattcacctagtcaacgatgccgaagtcaatgtctttaacggagac
ctaggctacatcacagacctgattcctggaaaatacaccgagtccaaacaagacgagatt
gtcattgattttgatggcaatgaggtcatctatccacgcaacgaatggtacaagattcga
ctagcctatgccatgagtatccataagtctcagggaagtgagtttcctgttgtcatcctg
cccatcaccagtgctagcaagcgcatgctggagcgaaatctcatctacacagccattaca
cgggccaagagcaagctcatccttcttggtgaattacaggccttcgactatgcagtcaag
catatcgggactgcccgtaagacctatctgattgagcgctttaaggatctggttgaagca
actgaccaaaccagcccagctcctagcgaaacaacaaatcaagaggattctcctctatcc
tacatcctcaccgaggaaaactggtctagtattcacgctatgattgggattacagatgtc
gatctcaaagagatttttggaaaatag

DBGET integrated database retrieval system