KEGG   Streptococcus oralis: SOR_1727Help
Entry
SOR_1727          CDS       T01476                                 

Definition
glycosyl hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sor  Streptococcus oralis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_1727
Enzymes [BR:sor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SOR_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1706269..1707648)
Genome map
AA seq 459 aa AA seqDB search
MLKFPKDFVWGSSTSGPQTEGRVPGDGKGDNLWDYWYQVEPNRYYNGIGPDKTSTFYENW
KKDIELLVETGHTAFRTSIQWSRIFPQGRGEVNPQGVTFYRQVFEDIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKETVKAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAKAAVKVAYHTQLASSLAVKACHEILPDSKIGIVLNLTPAYPRSQHPADVKAAR
IADLFQAQSFLDPSVLGAYPEELVEILAEYDLLPEYTVEELELIREHTVDFLGVNYYQPL
RVMAPRFAKHPDSPLLPEHFYEPYIMPGRKINPHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEDKFRVNGMIQDDYRIDFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGHWFKELSYRNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatttccaaaggattttgtctggggttcctccacttctggaccacagacagaa
ggacgagtgccaggtgatggcaagggagataatctctgggattattggtatcaggtggag
ccaaaccgttattacaatggaattggacctgacaaaacatctaccttctatgaaaactgg
aaaaaggatattgagcttttggtagagactgggcatacagccttccgaacttctatccag
tggtctcgtattttcccacaggggcgtggagaggtcaatccgcaaggggtgactttctac
cgtcaggtctttgaagacattaaggccaaggggattcgtctcttagtcaatctctatcac
ttcgacctgccatttgccctccaagaagacggcgatggttgggaaaataaggaaactgtc
aaggcttatgaagactatgctcgtttttgttttgagacttacggcgacttggtggaccaa
tggattacctttaacgagcccattgtccctgtagaatttggctatttctatgatgcccac
tatcctcataaggtagatgccaaagcggcggttaaggttgcttatcatacgcaactggct
agtagtcttgcggttaaggcttgtcatgagattttgcctgattctaagattgggattgtt
ctcaacttgacaccagcctacccacgtagtcagcatcccgcagatgtcaaggctgcgcgc
attgccgacctctttcaagcccaatctttcctagacccgtctgtcttgggagcttatcca
gaagagttagtagagattttagctgagtatgatttgctgccagagtacactgttgaagag
ttagaactcattcgggagcatacagtggactttcttggagtcaattactaccaacctttg
cgcgttatggcgccacgttttgctaagcatccagacagtccactcttgccagaacatttc
tatgagccttatatcatgccgggccgtaaaatcaatcctcaccgcggttgggaaatctac
gagcaggggatttatgatatcgctcaaaatatcaaggaaaattatggtaatatcgagtgg
atgttgacagagaatggcatgggtgttgaaggggaagataaattccgtgtgaatggcatg
attcaggacgactatcgtattgactttgtcaaagggcatctgcgtgaactccaccgtgct
atcgaagacggtgctaactgtaagggctacttgatttggacctttattgattgctggtca
tggctcaacagttataaaaatcgctacggtctggttgagcttgacttggaaacgcaggaa
cgtcgcctgaagaaatcaggccactggtttaaggaactcagctatcgtaatggattttaa

DBGET integrated database retrieval system