KEGG   Streptococcus oralis: SOR_1811Help
Entry
SOR_1811          CDS       T01476                                 

Gene name
ruvA
Definition
Holiday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sor  Streptococcus oralis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sor03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1771546..1772139)
Genome map
AA seq 197 aa AA seqDB search
MYEYLKGIITKITAKYIILEANGIGYILHVANPYAYSGQVNQETQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVASDDLPSKVAVQTSAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatctaaaaggaatcattaccaaaatcactgctaaatatatcatccttgag
gcaaatggtatcggttatatcttgcatgtagccaatccctatgcctactcaggtcaggtc
aatcaagaaactcagatttatgtgcaccaagttgttcgtgaggatgcccatctgctctac
ggttttcgctcagaagatgagaaaaagctctttctcagtctgatctcggtctcagggatt
ggtcctgtgtcagctcttgctatcatcgcagctgatgacaatgctggcttggttcaagcg
atcgagactaagaacatcacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtcgtggctagtgatgaccttccttcc
aaggtcgcagtgcaaaccagcgctgaaaaccaagaactggaagaagctatggaagccatg
ctggcactgggctacaaggcgactgaacttaagaaaatcaagaaattctttgaaggaacg
acggatacagcagagaactatatcaagtcggcccttaagatgttggtcaaatag

DBGET integrated database retrieval system