KEGG   Streptococcus oralis: SOR_1831Help
Entry
SOR_1831          CDS       T01476                                 

Definition
(GenBank) deacylase, putative
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sor  Streptococcus oralis
Pathway
sor00300  Lysine biosynthesis
sor01100  Metabolic pathways
sor01120  Microbial metabolism in diverse environments
sor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SOR_1831
Enzymes [BR:sor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SOR_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BMC
Motif
Other DBs
NCBI-ProteinID: CBZ01478
UniProt: F2QFQ9
Position
complement(1791810..1793183)
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTENPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASMDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLIQALSSLR
AADGRILVEGLYEDVQGPNERELALVDTYAQRNPEEISRIYGLELPLLQEDRAAFLKRFF
FEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagagcagattgaaaaatttgagaaggatcatgtggcccaa
cattatttcgaagtcttacgcaccttaatttccaagaaatccgtctttgcccagcaggtt
ggactcaaggaagtcgcaaactatctgggtgagattttcaagcgtgtgggggctgaagtg
gagattgatgagagctacacggctccctttgtcatggcgcatttcaagagttcgcgtccg
gatgccaagaccttgatcttctataatcactatgacaccgtgccagcggatggcgaccag
gtgtggacagagaatccttttaccctttctgtgcgaaatggctttatgtatgggcgtggg
gttgacgacgacaaaggccacatcacagctcgtttgagtgctttgagaaagtatatgcag
caccatgatgacctgcctgtcaatatcagctttatcatggaaggggcagaggaatctgct
tccatggatctagataagtatttagagaaacacgcggacaaactccgtggggcggatttg
ttggtctgggaacaaggaaccaaaaatgccttggaacagttagaaatttctggtggaaac
aaggggattgtgacctttgatgctaaggtgaagagtgcggatgtggatatccactcgagt
tatggtggtgtcgtggagtcagcaccgtggtatcttatccaggccttaagtagcctacgt
gccgcagatggacgtatcttggtagaaggcttgtacgaggatgttcaagggccaaatgaa
cgagaactagccttggtagatacctatgcccaacgcaatccagaggaaattagtcgcatt
tatggtttggaattacctctcttacaagaggatcgtgcagcctttctaaaacgtttcttt
tttgagccagcccttaatatcgaagggattcagtcaggttatcaagggcaaggggttaaa
actattttgccagcagaagccagtgctaagctagaggttcgtttggttcctggtctagaa
ccgcatgatgttctggaaaaaattcggaaacagctagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagttatcgaagcgatatgagcgcgccggccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtctcagtcttgccgacc
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggtggcc
ttcggtctaggaaatgccaatagtcgagaccacggtggagatgaaaatgtgcgaatcgcc
gattactacacccatattgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system