KEGG   Streptococcus oralis: SOR_1916Help
Entry
SOR_1916          CDS       T01476                                 

Gene name
glpD
Definition
glycerol-3-phosphate dehydrogenase (EC:1.1.5.3)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sor  Streptococcus oralis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sor00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880578..1882404)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVSNTPAANKVLSKEEVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVRAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFSEANITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFNNLIATVEAYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKAAYHADVEAALAQ
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattgtcaattaaaaaaatgcaggaacgcaccttg
gatctcttgattattggtggagggattacaggagctggtgtagctttgcaggcagcagct
agtggtcttgacactggattgattgaaatgcaggacttcgcagaaggaacatccagccga
tcaacaaaattagtccacggaggtctgcgttacctcaaacaattcgacgtagaagtggta
tcagatacagtttctgaacgtgcggtggttcaacaaatcgctccacatattccaaagcca
gatccaatgctcttgccagtttacgatgaagatggagcgacctttagcctcttccgtctt
aaagtagccatggacttgtacgaccttttggcaggtgttagcaatacgccagctgctaac
aaggtcttgagcaaagaagaagtcttggaacgccagccaaacttgaagaaagaaggcttg
gtaggaggtggggtttaccttgacttccgtaacaatgatgcgcgtctcgtgattgaaaac
attaaacgtgccaatcaagatggtgccctcattgccaaccacgttagggcagaaggtttc
ctctttgacgaaagtggcaagattacaggtgttgtagctcgtgatttgttgacagaccaa
gtctttgaaatcaaggctcgtttggttatcaacacgacaggtccatggagcgacaaggta
cgcaatctgtctaataagggaacgcaattctcacaaatgcgtccaaccaagggagttcac
ttggtagtggattcaagtaagatcaaggtttcacagccagtttactttgacacaggtttg
ggagatggccgtatggtctttgttctcccacgtgaaaacaagacctactttggtacaacc
gatacagactacacaggtgatttggaacatccaaaagtgacgcaggaagatgtagattat
ctacttggtattgtcaacaaccgcttctcagaagccaacatcaccattgatgatatcgaa
agcagctgggctggtcttcgtccattgatcgcaggtaatagcgcttctgactacaatgga
ggaaataacggaaccatcagtgatgaaagctttaacaacttgattgcgactgttgaagct
tatctatcgaaagaaaaaacgcgtgaagatgttgagtctgctgtcagcaagcttgaaagc
agcacatctgagaagcatttggatccatctgcagtttcacgtggttcgagcttggatcgt
gatgataatggtcttttgacccttgctggtggtaaaatcacagactaccgtaagatggct
gaaggggctatggagcgcgtggtcgacatcctcaaagcagaatttgaccgtagctttaaa
ctcatcaattctaagacttaccctgtttcaggtggagaattgaacccagcaaatgtggac
tcagaaattgaagcctttgctcaacttggagtgtcgcgtggtttggatagcaaggaagct
cattacttagcaaatctatacggttcaaatgctccgaaagtctttgcccttgctcacagc
ttggaacaagcgccaggactcagcttggcagataccttatcccttcactatgcaatgcgc
aatgaattggctcttagcccagttgacttcctccttcgccgtaccaaccacatgctcttc
atgcgtgatagtttagatagcatcgttgagccagttctggatgaaatgggacgattctat
gattggactgaagaagaaaaagcagcctaccatgcggatgttgaagcagctcttgctcaa
aacgatttggcagaactaaaaaattaa

DBGET integrated database retrieval system