KEGG   Solanum tuberosum (potato): 102577487Help
Entry
102577487         CDS       T02981                                 

Definition
dihydroflavonol 4-reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sot  Solanum tuberosum (potato)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    102577487
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     102577487
    1.1.1.234  flavanone 4-reductase
     102577487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 382 aa AA seqDB search
MASEVHSVVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHL
LELPKADTNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGML
SIIESCAKANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKI
LAEKAAMKEAKKNNINFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQY
VHLDDLCEAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLP
IVSFSSKKLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSSADNGKDKEAIPISTEN
YSSGKENAPVANCTGKFTNGEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgaagttcattcagttgttgatgcccattctcccccgaagacgccaacggtt
tgcgtcacaggagcagctggatttatcggctcttggcttgtcatgagactccttgaacgc
ggttataatgtccatgctactgttcgtgatcctgagaaccagaagaaggtgaaacatctg
ttggaactgccaaaagctgatacaaacttaacgctgtggaaagcagacttggcagtggaa
ggaagctttgatgaagccattcaaggctgtcaaggagtatttcatgtggctacaccgatg
gatttcgagtccaaggatccagagaacgaagtaattaaaccaacagtcaggggaatgcta
agtatcatagaatcatgtgctaaagctaacacagtgaagaggctggttttcacttcatct
gctggaactcttgatgtccaagaggaccaaaaactcttctatgacgagaccagctggagc
gatttggacttcatatatgctaagaagatgacaggatggatgtattttgtttccaagata
ctggcagagaaggctgcaatgaaagaagctaaaaagaataacattaatttcattagcatc
ataccaccactggttgttggtccattcatcacacctacgttcccacctagcttaatcact
gccctttcactaattaccgggaatgaagctcactacggcatcattaaacaaggtcaatat
gtgcatttggatgatctttgtgaggctcatatattcctgtatgagcaccccaaggcagag
ggaagattcatttgctcgtcccatcatgctatcatctacgatgtggctaagatggtgcga
cagaaatggccagagtactatgttcctactgagtttaagggtatcgataaggacttgccc
atagtgtctttttcatcaaagaagcttatggacatggggtttcaattcaaatacactttg
gaggatatgtataaaggggccattgagacttgccgacagaagcagttgcttcccttttct
acccgaagctctgcagacaatggaaaagacaaagaagcaattcccatttctactgaaaac
tattcaagtggcaaggagaatgcaccagttgccaattgtacaggaaagtttaccaatggt
gaaatctag

DBGET integrated database retrieval system