KEGG   Solanum tuberosum (potato): 102581558Help
Entry
102581558         CDS       T02981                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sot  Solanum tuberosum (potato)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102581558
   00500 Starch and sucrose metabolism
    102581558
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102581558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 653 aa AA seqDB search
MSIPNSESNNGVPYTQLPESDNDSGNTPASSCRRPKKSTFMILTGLVAFLLFFVAVKYGN
NDDSDDVNPGPVPPEQTVCNMLGSNLMPLTTMRTLARGVTEGVSAKSRGHFLGARPFPWT
QKMLAWQRTSFHFQPKKNWMNDPNGPLYYKGWYHLFYQYNPEAAVWGNIVWGHAVSKDLI
HWQHLPVAMVADQWYDINGVWTGSATFLPNGDLIMLYTGSTNELVQVQNLAYPADPSDPL
LKKWIKYEGNPVLIPPPGIGLKDFRDPTTAWTTPEGKWRITIGSKINKTGISLVYDTIDF
KKFELLKGALHGVPGTGMWECVDFYPVSKIVENGLDTSENGPAVKHVLKSSLDDDRNDYY
ALGTYDAGAGKWVPDNPIIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWIKETDSEAA
DICRGWASLQSIPRTIKYDKKTGSNIITWPVAEVENLRSNNNEFNKVVVKPGSIVPLEVG
SATQLDIMAEFEIDQNVLKKVDGSNATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTP
IYFYIAKDLTGNFNTFFCNDLTRSSEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVES
FAQNGRTAITSRVYPTKAIYENAKIYLFNNATDISVTATIKIWQMNSANIKSN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccctaattcagaatcaaacaacggcgttccgtacactcaattaccggagtcg
gataacgactccggtaatactccggcatcatcttgccggagacccaaaaaatcgacgttc
atgatattaaccggtttagtggcatttttgttattttttgtggcagtgaaatacgggaac
aacgacgatagtgatgatgtaaatccgggaccggtaccaccggaacagacggtgtgcaac
atgctcggttcgaatctaatgccgttaaccaccatgaggacgttggcgcgtggcgtgacg
gaaggtgtttctgccaagtcacgcggacattttttgggtgcacggccgtttccgtggacc
caaaaaatgttggcttggcaaagaacgtcgtttcattttcaacctaagaagaattggatg
aatgatcctaatggtccattatactacaaaggatggtatcatttgttctatcaatacaat
ccagaggcagctgtatggggaaatattgtatggggccatgcagtctcaaaagacctaatc
cactggcagcatctgccagtggctatggtagcggaccaatggtatgacattaacggtgtc
tggactggatccgctacttttttacctaatggtgaccttatcatgttatataccgggtca
accaacgaattggtccaagtccaaaatctcgcgtacccggccgacccatcggaccctcta
ttaaaaaaatggatcaagtatgagggcaacccggttctcatcccaccacccggaattggg
ctcaaggacttccgtgaccccaccaccgcgtggaccacaccggaaggcaaatggcgtatt
actattggttcaaagattaataaaaccggaatctcattggtctatgacacaattgatttt
aaaaaatttgaattgttgaagggtgcgttacatggtgtaccgggtacgggtatgtgggaa
tgtgtggatttttacccggtttctaaaattgttgaaaatgggcttgacacttcagaaaat
gggcctgcagtgaaacatgttttgaagtccagtcttgacgatgatcgaaatgactattat
gcccttggaacttatgatgcaggggcaggaaaatgggtacctgataatccaataattgat
gttggtattgggttaagatatgattatggtaatttttatgcatcaaaaacattttatgat
caagaaaaaaagagaagagttctttgggcttggattaaagaaactgatagtgaagctgct
gatatttgcaggggttgggcctcacttcagtcaattccaagaactataaagtatgataag
aagacaggaagcaacataattacatggccagtggctgaggtagagaatttgagatcaaac
aacaatgaattcaacaaggttgtagttaaaccaggttcaattgtcccactagaagttggt
tctgccactcagttggacataatggctgaatttgaaatagaccaaaatgtgttgaagaaa
gtagatggaagtaatgctacatatgattgtataaagagtggtggatctggtgaacgtggt
gcattaggaccatttggtttattagttctaacagataatagcttatcagaacaaactcca
atttatttctacattgctaaagatcttactggcaatttcaacacttttttctgcaatgat
ctcacaaggtcatctgaagcaacagatgtacgcaaattaatctatggaagcacagttcca
gttctccaaggagaaaaactttctctaaggacactggttgatcattcgatagtagaaagt
tttgcacaaaatggaaggacagcaataacatcaagggtatatccgacaaaagcaatatat
gaaaatgctaagatctatttattcaataatgcaacagatattagcgttactgcaacaatc
aagatttggcaaatgaattctgcaaatataaaatctaattaa

DBGET integrated database retrieval system