KEGG   Solanum tuberosum (potato): 102584095Help
Entry
102584095         CDS       T02981                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sot  Solanum tuberosum (potato)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102584095
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102584095
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102584095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 948 aa AA seqDB search
MFENGVDEEERPPCSDSLLHKVHPGKPPLLTWQRKLNSSASTPTSFAPSIREILHMLPLG
LRLWRHIHEEAAKGTPSIMDPYNKRLLSCYHGVPLGGIGAGSIGRSLRGEFQRFQLFPRK
CEDTPILANQFSIFIARPDQEKFSTVLCSRGPEELKTDESWKWKLDGENCTYHALYPRAW
TVYDAGVPDPELSIVCRQLSPFIPHNYKDSSFPVTVFTFTLSNSGKTDADVTLLFTWANS
VGGISEFSGGHVNKKILMEDSVHSILLHHNTSDGLPPVTFSIAAQETPDVHVSECPCFSI
SGESEIMTAKDMWREIEEHGSFDHLKDAKTLVTSVKGSSIGAALAASVKVSSGAVRTVTF
SLAWDCPEIRFPGGKTYHRRYTKFYGVQGDGAASIAHDALLEHNNWEHEIDKWQKPILED
TSLPEWYRITLFNELYYLNAGGTIWTDGSLPIQNFGTIRERAFSLEKTKSDSEETLKLDE
KNETYMGLLSRMKSTVNQLQTPVTSNCAFGTYLLQDGEENIGQFLYLEGIEYHMFNTYDV
HFYASYALLMLFPKLELSIQRDCAMAVMMHDPSKMKIMSDGTWVSRKVLGAVPHDIGLND
PWFEVNAYNFFNTDRWKDLNSKFVLQVYRDFVATGDKFFGKAVWPSVYIAIAYMDQFDKD
GDGMIENEGFPDQTYDAWTVSGVSTYSGGLWVAAVQAASAMAHEVGDAAAADYLWAKFQK
AKSVYEKLWNGSYFNYDNSGRRSSSSIHADQLAGQWYARASGLSPIADEEKIRTALKKIY
DFNVLKHKGGMCGAVNGMLPSGKPDMSALQSREIWTGVTYSLAANMIQEGLVDIAFQTAS
GIHSTAWSDKGLGFGFQTPEGWNTYAHYRSLCYMRPLAIWAMQWALSKPKLHNQEMKQMS
SSLSENSSYVKQDAGFQEVARLLKLPKQQASTSYIQSLHQFLCNKFSI
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaatggagttgacgaggaagaacgaccaccttgttctgattcattgttgcat
aaggttcatcctggaaaacctcctttactcacatggcagcggaagttaaattcttcagca
agtacccctacatcttttgctcctagcattcgagaaattttgcacatgcttccacttggt
ctaaggttgtggaggcatatacatgaagaagctgcaaaaggaacgccctcaatcatggat
ccgtacaacaagcgtcttctctcatgttatcatggcgttccattaggtggtattggtgca
ggaagtattggaagaagtttgagaggtgaatttcaacgctttcaattattccccagaaaa
tgtgaagacacacctattctagcaaaccagttttcaatattcattgctcgccctgatcaa
gaaaagttttcaaccgtgctgtgctccagaggtcccgaagagctcaaaacggatgaatca
tggaaatggaagctagatggggagaactgcacatatcatgctttatacccaagagcgtgg
actgtatatgatgcaggtgttccagatcctgaacttagcattgtttgtcgtcagctttca
ccatttattccacataattacaaggacagcagcttcccagtcactgtattcacatttacg
ctttctaactcagggaagactgatgctgatgtgacattacttttcacatgggctaattca
gtgggtggtatatcagagttctctggtggacatgttaataaaaagattttgatggaagat
agtgtgcatagcatcctccttcatcataacacttcagatggactccctccagtaaccttt
tccattgcagcccaagaaactcctgatgtccatgtctcagaatgtccatgcttttcgatt
tctggagagtctgagattatgacagcaaaggacatgtggagggaaattgaggagcacggt
tcatttgatcatcttaaggatgctaagaccttggtaacttcagtaaaaggatcatctatt
ggagctgctttagcagcatctgttaaagtttcatctggtgctgtccggacagtaactttt
tcacttgcgtgggactgtccagaaataagatttcccggaggcaagacttaccacagacga
tatacaaaattctatggtgttcaaggtgacggtgcagcaagtattgcccatgatgccctc
ctagaacataacaattgggagcatgagattgacaagtggcagaaaccaatacttgaagac
acaagtctgccagaatggtaccgcatcactcttttcaatgagctctattatcttaatgct
ggtggcacaatttggacagatgggtccttaccaattcaaaactttggaaccatcagggag
agagcgttttcccttgaaaagacaaaatcagattctgaggaaacgttaaagttggacgaa
aaaaatgagacttatatgggattactttctaggatgaaatctactgttaaccaacttcag
actccggtgacttcaaactgtgcttttggtacttatctacttcaagacggagaggagaac
attggccagtttctttatcttgaaggaattgaatatcacatgtttaatacgtatgatgtc
catttttatgcatcatatgcgctattaatgctcttcccaaaacttgagctgagcatccaa
agagactgtgcaatggcggtaatgatgcatgatccatctaaaatgaaaattatgagtgat
ggaacatgggtctccagaaaggttcttggagctgtccctcatgatattggacttaacgat
ccatggtttgaagttaatgcatacaatttcttcaacacagatagatggaaggacttaaat
tcgaaatttgtccttcaagtttatagggattttgttgctaccggtgataaattttttgga
aaagctgtttggccatcggtatacatagctatagcatatatggatcagtttgataaggat
ggagatggcatgatagaaaatgaagggttccctgatcaaacgtacgatgcatggactgtt
agtggtgtgagcacatatagtggagggctctgggtagcagctgtacaagctgcctcggca
atggctcatgaggtcggtgatgctgcagctgctgattacctttgggctaagtttcagaag
gcaaagtctgtatatgagaagttatggaatggttcttactttaattatgataatagtggt
cgaagatcaagttcttcaattcatgctgatcagttggctggtcaatggtatgctagagcg
agtggtctttcacctattgctgatgaagagaagataagaacagctctgaagaaaatctat
gatttcaatgtgttaaagcacaagggagggatgtgtggggctgtaaatgggatgctacca
agtggaaaacctgatatgtcagctctgcagtcgagagaaatatggacaggagttacgtat
tctcttgctgctaatatgatacaagagggcttggtggacatagcatttcaaactgcaagt
ggaatacactcgacagcttggtcagataaaggtcttgggtttggtttccaaacgccggaa
gggtggaacacatatgctcactatagatcactgtgttatatgaggccgttggcgatttgg
gcaatgcaatgggctctatcaaaaccaaagcttcacaaccaggagatgaagcagatgagt
agtagtctaagtgagaattcttcctatgtaaaacaggatgcaggatttcaagaggttgct
cgccttctcaagttaccaaaacaacaagcttctacaagttacattcagtcgttgcatcag
tttctttgtaacaaattctcaatttga

DBGET integrated database retrieval system