KEGG   Solanum tuberosum (potato): 102584794Help
Entry
102584794         CDS       T02981                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102584794
Transcription machinery [BR:sot03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102584794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 544 aa AA seqDB search
MDALSSHLTAPARSRSSQSPSPSHSASASATSSIHKRKMASDDHAPPFPSSFSDTRDGAL
TSNDDLESISARGGGADSDSEDDSEEVGDDDEEDYDASSMRNFTASRLETSVAMVPSGRN
TKLKSDNSVKNESSEIAKEAGTGCSGNVAPPTATGSVSGAVVKDESMKNIFTDNLQTSGA
YTAREESLKREEESGRLKFVCVSNDGVDEHMIWLVGLKNIFARQLPNMPKEYIVRLVMDR
NHKSVMVIRRNLVVGGITYRPYTSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVD
GLTHFLTYADNNAVGYFVKQGFTKEIYLEKERWQGYIKDYDGGILMECKIDPKLPYTNLS
TMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGIPKKAIKVEDIPGLREAGWTPDQYG
HSRFKTVNSLSDQKSLTAFMRSLLKIMHDHPDSWPFKEPVDARDVPDYYDIIKDPIDLKT
MSKRVESELYYVTFDMFLADVRRMFANARTYNSPETIYYKCSTRLESHFSNKVQAGLQSS
IKIQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggacgctctctcatcgcacttgacggcgccggcccgatcccggagttcacaatctccg
tcaccctcacattctgcgtcggcctcagcaacctcgtcgatccacaaacgcaagatggca
tctgatgaccacgcgccgcctttcccgtcctctttctctgacacgcgcgacggcgctctt
acctccaacgatgacttagagagtatcagcgcccgcggaggcggtgctgattccgactcc
gaagatgactccgaagaggtcggtgatgatgacgaagaagattatgatgcttcttccatg
cgcaatttcactgcctcgcggttggagactagcgtggctatggtaccctcagggaggaat
actaagcttaagagtgataattcagtaaaaaatgagtcttccgagatagcgaaagaagct
ggcactggttgttccggtaatgttgcgccacctactgccactggttctgtttcaggggcg
gtagtgaaggatgagagtatgaagaatatttttactgacaatttacagactagtggtgct
tatacagcaagggaagagagcttaaagagggaggaggaatcaggaagactcaagtttgta
tgtgtttcaaacgatggtgttgatgagcatatgatttggttagtaggattgaagaatata
tttgcaaggcaactaccaaacatgcctaaggaatatattgttcgtcttgtgatggacaga
aaccataagtctgtaatggtcatcagacgcaatctggtggttggtggtataacatatcgt
ccatataccagccagaagtttggggagatagctttttgtgcaattacagcagatgaacaa
gttaagggctatggcaccagactgatgaatcacttaaagcagcatgcacgcgatgtggat
gggctgactcattttctaacatatgctgacaacaatgctgttggttactttgtcaaacag
ggattcacgaaagagatttatttagagaaagagcgttggcaagggtatattaaagattat
gatggtggaatccttatggaatgcaaaatagatccaaagcttccatacacgaatttatct
actatgatacgtcgtcaaaggcaggcaattgatgaaaagataagggagctatcaaattgt
catattgtctacccaggaattgattttcaaaagaaggaagctggcattcccaaaaaggcc
atcaaggttgaggatatccctggcttgagagaggctggatggactcctgatcaatatggt
cattctcgtttcaaaacagtaaactccttgtcagatcagaaatctttgactgcattcatg
cgctcactcctgaaaataatgcatgaccatcccgattcctggccgttcaaagaacctgtt
gatgcacgggatgttcctgattattatgacatcatcaaagatccaatagatttaaaaaca
atgtcaaagcgggttgagtcggagttatattatgtgacatttgatatgtttttggcggat
gtgagaaggatgtttgctaatgctcgcacctataactctcctgagaccatttactacaaa
tgttcaaccaggcttgaatcacatttctcaaacaaagttcaagctggtctacagtctagc
atcaagattcagtag

DBGET integrated database retrieval system