KEGG   Solanum tuberosum (potato): 102587739Help
Entry
102587739         CDS       T02981                                 

Definition
(RefSeq) protoporphyrinogen oxidase, mitochondrial
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00860  Porphyrin and chlorophyll metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Module
sot_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102587739
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102587739
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     102587739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO Pyr_redox_2 HI0933_like Pyr_redox AlaDh_PNT_C Thi4 FAD_oxidored FMO-like FAD_binding_3 GIDA IlvN Pyr_redox_3 NAD_binding_9 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 102587739
NCBI-ProteinID: XP_006356026
Position
Un
AA seq 507 aa AA seqDB search
MVPMAPSAGEDKQNCPKRVAVIGAGVSGLAAAYKLKIHGLDVTVFEAEGRAGGKLRSLSQ
DGLIWDEGANTMTESEGDVTFLLDSLGLREKQQFPLSQNKRYIARNGTPTLIPSNPIDLI
KSNFLSTGSKLQMLFEPLLWKNKKLTKVADEHESVSGFFQRHFGKEVVDYLIDPFVAGTC
GGDPDSLSMHLSFPELWNLEKRFGSVIVGAIRSKLSPIKEKKQGPPKTSVNKKRQRGSFS
FLGGMQTLTDAICNDLKEDELRLNSRVLELSCSCSGDSATDSWSIFSASPHKRQAEEESF
DAVIMTAPLCDVKGMKIAKRGNPFLLNFIPEVDYVPLSVVITTFKKESVKHPLEGFGVLV
PSEEQKHGLKTLGTLFSSMMFPDRAPNNVYLYTTFVGGSRNRELAKASRTELKEIVTSDL
KQLLGAEGEPTYVNHVCWSKAFPLYGHNYDSVLDAIDKMEKNLPGLFYAGNHKGGLSVGK
ALSSGCNAADLVISYLEAVSTDTKNHS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggttccgatggctccatctgccggagaagataaacaaaattgtcccaagagagttgca
gtcattggtgctggcgtcagtggacttgctgcagcatacaagttgaaaattcatggcttg
gatgtcacagtattcgaagcagaagggagagctggagggaagttacgaagcctgagtcaa
gatggcctaatatgggatgaaggcgcaaatactatgactgaaagtgaaggtgatgtcaca
tttttgcttgattcgcttggactccgagaaaaacaacaatttccactttcacagaacaag
cgctacattgccagaaatggtactcctactctgataccttcaaatccaattgacctgatc
aaaagcaattttctttccactggatcaaagcttcagatgcttttcgagccacttttgtgg
aagaataaaaagcttacaaaggtggctgacgaacacgaaagtgtcagtggattcttccag
cgtcattttggaaaggaggttgttgactatctaattgatccttttgttgctggaacatgt
ggtggtgatcctgactcgctttcaatgcacctttcgtttccagagttgtggaatttagag
aaaaggtttggctcagtcatagttggggcaattcgatccaagttatcacctataaaggaa
aagaaacaaggaccacccaaaacttcagtaaataagaagcgccagcgggggtccttttca
tttttgggcggaatgcaaacacttactgacgcaatatgcaatgatctcaaagaagatgaa
cttaggctaaactctagagttctggaattatcttgtagctgtagtggggactctgcgaca
gatagctggtcaattttttctgcctcaccacacaagcggcaagcagaagaagaatcattt
gatgctgtaattatgacggcccctctctgtgacgttaagggtatgaagattgctaagaga
ggaaatccatttctgctcaactttattcctgaggttgattatgtaccactatctgttgtt
ataaccacatttaagaaggagagtgtaaagcatcctcttgagggttttggagtgcttgta
ccttccgaggagcaaaaacatggtctgaagacattaggcaccctcttctcttctatgatg
tttccagatcgtgcacccaacaatgtctatctctatactacatttgttggtggaagccga
aatagagaactcgcgaaagcctcgaggactgagctgaaagagatagtaacttctgacctt
aagcagttgttgggtgctgagggagagccaacatatgtgaatcatgtatgctggagtaaa
gcatttccgttgtatgggcataactatgattcagtcctcgatgcaattgacaaaatggag
aaaaatcttcctggattattctatgcaggtaaccacaagggaggattgtcagttggcaaa
gcactatcttctggatgtaatgcagcagatcttgttatatcatatcttgaagccgtttca
acggacaccaaaaaccatagctga

DBGET integrated database retrieval system