KEGG   Solanum tuberosum (potato): 102587739Help
Entry
102587739         CDS       T02981                                 

Definition
protoporphyrinogen oxidase, mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sot  Solanum tuberosum (potato)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102587739
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102587739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MVPMAPSAGEDKQNCPKRVAVIGAGVSGLAAAYKLKIHGLDVTVFEAEGRAGGKLRSLSQ
DGLIWDEGANTMTESEGDVTFLLDSLGLREKQQFPLSQNKRYIARNGTPTLIPSNPIDLI
KSNFLSTGSKLQMLFEPLLWKNKKLTKVADEHESVSGFFQRHFGKEVVDYLIDPFVAGTC
GGDPDSLSMHLSFPELWNLEKRFGSVIVGAIRSKLSPIKEKKQGPPKTSVNKKRQRGSFS
FLGGMQTLTDAICNDLKEDELRLNSRVLELSCSCSGDSATDSWSIFSASPHKRQAEEESF
DAVIMTAPLCDVKGMKIAKRGNPFLLNFIPEVDYVPLSVVITTFKKESVKHPLEGFGVLV
PSEEQKHGLKTLGTLFSSMMFPDRAPNNVYLYTTFVGGSRNRELAKASRTELKEIVTSDL
KQLLGAEGEPTYVNHVCWSKAFPLYGHNYDSVLDAIDKMEKNLPGLFYAGNHKGGLSVGK
ALSSGCNAADLVISYLEAVSTDTKNHS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggttccgatggctccatctgccggagaagataaacaaaattgtcccaagagagttgca
gtcattggtgctggcgtcagtggacttgctgcagcatacaagttgaaaattcatggcttg
gatgtcacagtattcgaagcagaagggagagctggagggaagttacgaagcctgagtcaa
gatggcctaatatgggatgaaggcgcaaatactatgactgaaagtgaaggtgatgtcaca
tttttgcttgattcgcttggactccgagaaaaacaacaatttccactttcacagaacaag
cgctacattgccagaaatggtactcctactctgataccttcaaatccaattgacctgatc
aaaagcaattttctttccactggatcaaagcttcagatgcttttcgagccacttttgtgg
aagaataaaaagcttacaaaggtggctgacgaacacgaaagtgtcagtggattcttccag
cgtcattttggaaaggaggttgttgactatctaattgatccttttgttgctggaacatgt
ggtggtgatcctgactcgctttcaatgcacctttcgtttccagagttgtggaatttagag
aaaaggtttggctcagtcatagttggggcaattcgatccaagttatcacctataaaggaa
aagaaacaaggaccacccaaaacttcagtaaataagaagcgccagcgggggtccttttca
tttttgggcggaatgcaaacacttactgacgcaatatgcaatgatctcaaagaagatgaa
cttaggctaaactctagagttctggaattatcttgtagctgtagtggggactctgcgaca
gatagctggtcaattttttctgcctcaccacacaagcggcaagcagaagaagaatcattt
gatgctgtaattatgacggcccctctctgtgacgttaagggtatgaagattgctaagaga
ggaaatccatttctgctcaactttattcctgaggttgattatgtaccactatctgttgtt
ataaccacatttaagaaggagagtgtaaagcatcctcttgagggttttggagtgcttgta
ccttccgaggagcaaaaacatggtctgaagacattaggcaccctcttctcttctatgatg
tttccagatcgtgcacccaacaatgtctatctctatactacatttgttggtggaagccga
aatagagaactcgcgaaagcctcgaggactgagctgaaagagatagtaacttctgacctt
aagcagttgttgggtgctgagggagagccaacatatgtgaatcatgtatgctggagtaaa
gcatttccgttgtatgggcataactatgattcagtcctcgatgcaattgacaaaatggag
aaaaatcttcctggattattctatgcaggtaaccacaagggaggattgtcagttggcaaa
gcactatcttctggatgtaatgcagcagatcttgttatatcatatcttgaagccgtttca
acggacaccaaaaaccatagctga

DBGET integrated database retrieval system