KEGG   Solanum tuberosum (potato): 102589640Help
Entry
102589640         CDS       T02981                                 

Definition
(RefSeq) histone acetyltransferase of the MYST family 1-like
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102589640
Chromosome [BR:sot03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102589640
   HAT complexes
    NSL complex
     102589640
    MSL complex
     102589640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 447 aa AA seqDB search
MGSIDTSTRAESGSDPIPTPNGTANGLHAGEDPVQTPAVDSTGASAENESLRKRRGSGVL
PLEVGTRVMCRWRDGKYHPVKVIERRKFPCGGVNDYEYYVHYTEFNRRLDEWVKLEQLDL
NSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIE
LGRYEIETWYFSPFPPEYNDCSKLFFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRS
GTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFS
KEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGMLSYRG
YWTRVLLDILKKHKGNISIKELSDMTAIKAEDILSTLQGLELIQYRKGQHVICADPKVLD
RHLKAAGRGGLEVDVSKLIWTPYKEQN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgatagacacgtcaacgagggcagagagcggttcggacccaattccaacccct
aatggcaccgccaatgggctgcacgccggtgaggatcccgtccagacgccggcggtggac
tccaccggagcttcggcagagaacgaatccttgaggaagaggagaggtagtggtgtccta
ccgctcgaagtgggtactcgagtaatgtgccgctggagagacggcaagtaccatcccgtt
aaggtcattgaacgccggaaatttccctgcggtggtgttaatgactacgaatactatgtt
cattacactgaattcaaccggagacttgatgagtgggttaaacttgaacagcttgatctt
aattcagtagagactgttgtggatgagaaggtcgaggacaaggtgacaagtttaaaaatg
acacgccaccagaaacggaaaattgacgagactcatgtcgagggccatgaggagcttgat
gcggctagtttgcgagagcatgaagagttcacaaaagttaagaacattgctacaatagaa
cttggaagatatgagattgaaacgtggtacttctcaccatttcctccagaatacaatgac
tgttcgaaactgttcttttgtgagttttgtctcaattttatgaagcgcaaagaacagctt
cagaggcacatgagaaaatgcgatcttaagcatcctccaggtgatgagatctatagaagt
ggtacattgtcaatgtttgaggttgatggaaaaaagaacaaggtatatgggcaaaatcta
tgctacttggccaaattgtttcttgatcacaagactctttattatgatgttgacctgttc
ctcttttacgtgctttgtgaatgtgatgaccgaggttgtcatatggttggttacttttca
aaggaaaagcattcagaagagtcctataacttagcctgcattttgacgcttccaccttat
cagaggaaaggatatgggaaattcctgattgcattctcatatgaactttcaaagaaagaa
ggtaaagtgggcacaccagaaaggccgctttccgacttgggaatgttgagctataggggt
tactggacgcgtgtgcttctggatatattgaaaaagcacaagggcaatatatctatcaag
gaactaagtgacatgacagccatcaaggcagaagatattttgtccacccttcagggttta
gagttgatccaatatcgaaaggggcaacatgtcatctgcgcagacccgaaagtcttagat
cgtcatctcaaagctgctgggcggggtggcctggaagttgatgtcagcaaattgatatgg
actccgtacaaggagcaaaactga

DBGET integrated database retrieval system