KEGG   Solanum tuberosum (potato): 102593479Help
Entry
102593479         CDS       T02981                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102593479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 465 aa AA seqDB search
MGTKHHSSSDSISDPKKRRRVGFSKTDAGIEANDCITIYIVSSAEDVDSPSSFCLEPIDL
NQFFEDDGRIFGYQGLKITIWVSLISFHAYADISFESSSDGGRGITNVKYALQNIFAESL
VDEKDAFLQTFSTESHYVRSVVSNAETLQHKVSNGCSTESNCLLKSEPSDVEVFRIAGTP
VGHLYSRLVPLVLLLVDGSNPIDVLDPRWEIYLLVQERKDTQEDSLSRLLGFAAVYRFHR
YPGSTRMRLGQILVMPPYQRKGYGRFLLEVLNGVAVSENVYDLTIEEPEDSLQYVRLCID
VERLLVFDPIQQSLESVISHLKQENSLKKSYMCKYAPPLSAVEDVRKTLKINKKQFEQCW
EILIYLGLAPINKYMEIYQAIVSHRVKAEVVGIDSEGAGKQVIDVPTEYDQQMSFVMFKS
QNGESSSIETADNQSIVEEQLQKLVDKRMNQIKLIAEKVSAVHRQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaagcatcattcctcctccgattcaatcagcgatcccaaaaagcgccgtcgc
gtgggattctctaagaccgatgctggaattgaagctaacgactgcattactatatacata
gtttctagcgcagaggatgttgactccccaagcagtttctgtcttgaaccaattgacttg
aatcaattttttgaagacgatggcagaatatttgggtatcagggtctgaagatcactata
tgggttagcttgatatcctttcatgcctatgctgatatttcttttgaaagctcatcagat
ggtggcagagggatcacaaacgtaaagtatgcccttcagaatatttttgctgagagtctt
gttgatgaaaaagatgccttcctgcaaacattttcaactgaaagtcattatgttcggtct
gttgtctcaaatgctgaaacactgcagcataaagtttcaaatggctgtagcactgaatct
aattgtcttttgaaatcagagccttcagatgtagaggtattccggatcgctggcacgcct
gtaggacacctttatagtagattggtgccacttgtactactcttagtggatggtagcaat
cctattgacgtccttgatcctagatgggaaatttatctcctagtccaggaaaggaaagat
acccaggaggatagcctttcaaggttgcttggttttgcagctgtttatcgtttccatcgt
tatcctggaagtacacgcatgcgacttgggcagatactggttatgcctccttaccaacgt
aaaggttatggtcgttttcttcttgaggtgctgaacggggttgcagtatctgaaaatgtg
tatgacctgactattgaagagcctgaggattctcttcaatatgttcgattgtgcattgat
gttgagcgtttgcttgtatttgacccaatccagcaatccctagaatcagttatatcacat
ttaaagcaggaaaattctttgaaaaaaagctacatgtgcaagtatgctccaccactgagt
gctgttgaagatgtgaggaaaactttgaaaatcaacaagaagcagtttgagcaatgttgg
gagattcttatctatcttgggttggccccaattaacaaatatatggagatataccaggca
attgtttcacaccgagtaaaggctgaagttgtagggatagattcagagggtgcggggaag
caggtgattgatgtaccaactgaatatgatcagcagatgtcatttgtgatgttcaaatcg
cagaatggtgaatctagtagcatagagacggctgacaatcaaagtattgtggaggagcag
ctgcagaaactggtggataaacgaatgaatcagatcaagttgattgctgagaaggtttct
gctgttcatcggcaatga

DBGET integrated database retrieval system