KEGG   Solanum tuberosum (potato): 102595777Help
Entry
102595777         CDS       T02981                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102595777
Transfer RNA biogenesis [BR:sot03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102595777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 564 aa AA seqDB search
MAAAVAVAETRKLPRPGRGGVVSLGLTDEEARVRAITEIVNNMVELSRKGKDVDLNALKS
AACRKYGLSRAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA
TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
KVEFILMGGTFMSLPAEYRDYFTRNLHDALSGHTSANVEEAVAYSEHGATKCIGMTIETR
PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA
HMMPDLPNVGVERDLESFKEFFESPSFRTDGLKIYPTLVIRGTGLYELWKTGRYRNYPPE
QLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT
REAGIQDIHNKIRPEEVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP
ELTGKCSIVRELHVYGTAVPVHGRDTDKLQHQGYGTLLMEEAERIARREHRSTKIAVISG
VGTRHYYRKLGYELEGPYMVKSLV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtagcggtagcggagacccgaaagctcccgcggccgggaaggggcgga
gttgtgtccctcggcctgacagatgaagaagctagagttcgtgctataacggagatcgtc
aacaacatggtggaactctcacggaaaggcaaagatgtagacctaaatgcgctaaagtca
gcagcgtgccgcaaatacgggctctctcgggctcctaagttggtagagatgatcgctgct
ttgcctgactcagaacgtgaaacactgcttcccaaactccgagccaagcctgtccgtaca
gcctctggaatagctgtcgtagctgtaatgtccaagcctcatcgttgtcctcatatagct
accaccggaaacatttgtgtctattgccctggtggccctgattctgattttgagtacagt
acacagtcatacactggatatgagcctactagtatgcgagctattcgagctagatacaac
ccttatgtacaagctcgaagccggattgatcaacttaagagattgggtcacagtgttgac
aaggttgaatttatcttgatgggaggtacattcatgtcattgcctgctgaataccgtgat
tacttcacacggaatcttcatgatgctttatccggacatacttctgccaatgttgaagag
gctgtcgcgtactccgaacatggggcgacaaagtgcattgggatgacaattgaaacgagg
ccagactactgccttggacctcatttgagacaaatgctttcttacggttgtacgcggcta
gaaattggagtccagagtacatatgaggatgttgctcgtgacaccaatagaggccacact
gttgcagctgtggctgattgcttttgtttggcaaaagatgctggcttcaaggtggttgct
catatgatgcctgaccttccaaacgttggcgttgaaagagatttggagagtttcaaggaa
ttctttgaaagtccttcatttaggactgatggacttaaaatttatcctacacttgttatt
cgtggcacggggctttatgaactgtggaaaactggaaggtatagaaattatccgccagag
cagcttgtagacattgtagcaaggattctttctatggtgccaccttggacccgagtttac
agggtccagcgtgatatccctatgcctctagtgacttctggagttgagaaagggaatctc
cgagaattggctttagctcgaatggatgatcttggcttgaaatgccgagatgtccgaaca
cgcgaagctgggatccaggacattcacaacaagataaggcctgaagaggttgagcttgtt
cgccgtgattatactgcaaatgaaggatgggagactttcctttcatacgaagatacacgc
caggatattcttgttggattgctacggctgcggaagtgtgggcggaatgtgacttgccca
gaactcacgggaaagtgttcaattgttcgtgagcttcatgtgtatgggactgcagttcct
gttcatggtcgagacacagataagctgcagcaccagggttatggtactctgctgatggag
gaggctgagcggattgctcggagggagcataggtcgaccaaaatcgctgttatctcgggt
gtagggacccgacattactacagaaagctaggctatgagcttgaaggtccttacatggta
aaaagtcttgtgtag

DBGET integrated database retrieval system