KEGG   Solanum tuberosum (potato): 102598097Help
Entry
102598097         CDS       T02981                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102598097
Peptidases [BR:sot01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102598097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 234 aa AA seqDB search
MADIAKKWLPLEANPDVMNQFLWCRGVPPDEVECYDVYGLDEELLGMVPKPVLAVLFLYP
LTSQSEAERVQQDGETKVQDPTSTIYFMKQTVGNACGTIGLLHAIGNITSEIKLDEGSFL
DKFFKSTACMDPMERASFLESDREIEVAHSVAATAGDTEVPVNVDTHFICFTCVDGQLYE
LDGRKSGPISHGTSTPSSLLQDAAKVIQKMMQKNPDSMNFNVIAISKRVKGDAP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccgacattgctaagaaatggcttcctcttgaagctaatcctgatgtcatgaatcag
ttcctttggtgtcgtggtgttccaccggatgaggtagagtgctatgatgtttatgggttg
gatgaagaacttttgggaatggtacccaagccggtccttgctgttttgtttctctatcct
ctaacatcacagagtgaagcagagagagtacagcaagacggcgaaacaaaggtgcaggac
cccaccagtaccatttacttcatgaaacaaacagtgggaaatgcatgtggaacaattggt
ctacttcatgctattgggaatattacctcagagataaaacttgatgagggctcattcttg
gacaagttctttaaatcaactgcatgcatggacccgatggagcgtgcttcattccttgaa
agtgatagagaaatagaggttgctcattcagtagcagctactgctggtgacactgaggtt
ccagtaaatgtggacacccatttcatctgcttcacatgtgttgatggacaactctatgaa
cttgatggaaggaagtccggaccaatttcacatggtacatctactccaagcagcctgtta
caggatgctgctaaagttatacaaaagatgatgcaaaaaaatccagactcgatgaacttc
aacgtcattgccatatcgaagagagttaaaggtgatgctccatga

DBGET integrated database retrieval system