KEGG   Solanum tuberosum (potato): 102598323Help
Entry
102598323         CDS       T02981                                 

Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
sot  Solanum tuberosum (potato)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    102598323
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     102598323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 455 aa AA seqDB search
MVSEVVPIPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQVPTINLKEI
NSEDKEIREKCHQELKKAAVEWGVMHLVNHGISDELIDRVKVAGSTFFDLPVEEKEKYAN
DQASGNVQGYGSKLANSACGQLEWEDYFFHCVFPEDKRDMAIWPKTPADYIPATSEYAKQ
IRNLATKIFAVLSIGLGLEEGRLEKEVGGMEDLLLQMKINYYPKCPQPELALGVEAHTDV
SALTFILHNMVPGLQLFYEGKWVTAKCVPNSIIMHIGDTIEILSNGKYKSILHRGVVNKE
KVRISWAIFCEPPKEKIMLKPLPETVTEAEPSQFPPRTFAQHMAHKLFKKVDNDAAAEQK
VFKKDDQDSADVHKASEKDDCDIVAEHIVLKEDKQDSAVEQKAFKKVDQDVVAERKVLKE
DEQDAVAELKVFKKDDQDVVTEHKVLKDVPAKESK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgaagtggttccaattccttcaagagttgaaagcttggctaaaagtggaatc
caagtcattcctaaagagtatgtgaggccacaagaagagttaaatggtataggaaacatc
tttgaggatgagaagaaagatgaaggacctcaagtaccgacaattaatctgaaagaaatc
aactcagaggacaaggaaattcgcgaaaaatgccaccaggagttgaagaaagcagcagtg
gagtggggtgtaatgcacctcgttaaccatgggatatcggatgagctaattgatagagtc
aaggttgctggaagtaccttttttgatttacctgttgaagagaaggagaagtatgcaaat
gatcaagcttctggtaatgtccaaggctatggcagcaagctagcaaatagtgcttgtggt
cagcttgagtgggaggattacttctttcattgtgttttccccgaggacaagcgcgacatg
gccatctggcctaaaacccctgctgactacattccagcaacaagtgaatatgccaagcag
atcaggaacctagcaacaaagatttttgcagtgctttcgattgggttgggattggaagaa
ggaagactagaaaaggaagttggaggcatggaagacctgctgcttcaaatgaagattaac
tactaccccaaatgtccccaaccagaactagcacttggcgttgaagctcatactgatgtg
agtgcactgactttcatcctccacaatatggtgcctggcttgcaactcttttatgaaggg
aagtgggtaactgcaaagtgtgtgcctaattccataattatgcacattggggataccatt
gaaatcctaagcaatggaaagtacaagagcattcttcacagaggggttgtgaacaaagag
aaagtaaggatttcatgggctattttctgtgagcctccaaaggagaagattatgcttaag
cccctacctgagactgtcaccgaggctgagccatctcaattcccacctcgcacctttgca
cagcatatggcacacaagcttttcaagaaggttgataacgatgctgctgctgaacaaaaa
gtattcaagaaggatgatcaggattctgctgatgtacacaaagcctccgaaaaggatgat
tgcgatattgttgcggagcacatagtcctcaaggaggacaaacaggattctgctgttgaa
cagaaagccttcaagaaggttgatcaggatgttgttgctgagcgcaaagttctcaaggag
gacgagcaggatgcagttgctgagctcaaagttttcaagaaggatgatcaggatgttgtt
actgagcataaagtcctcaaggatgttcctgctaaagaatctaaatag

DBGET integrated database retrieval system