KEGG   Solanum tuberosum (potato): 102598337Help
Entry
102598337         CDS       T02981                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102598337
Peptidases [BR:sot01002]
 Cysteine Peptidases
  Family C86
   102598337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 186 aa AA seqDB search
MSQNMDEREVKIYHERQRLQFCLLHSLNNLFQGKDTFTRSDLNKIAEKLDVDDPNKGSWN
PVSLVFRPHHNEITGNYDINVLIAALQQKAKTVVWHDKRNGASSIGLDGTDDRLMGIVLN
VPVTKFSGLWRSRHWVTLRCIQGVWYNLDSDFIAPYAFKDTQQLREFLDRIITAGAEVLL
VMNDKQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaatatggatgaaagggaagtaaaaatatatcacgagaggcaaagattacag
ttttgcctcttacattctcttaacaatctcttccagggaaaagatacatttacaagatct
gatttaaataaaattgctgagaaacttgatgtggatgaccctaacaaggggagctggaat
cctgtatcacttgtttttagacctcatcataatgaaatcaccgggaactatgatatcaac
gtattgattgcagcgctccaacagaaagccaaaactgttgtttggcatgataagcgaaat
ggggcttcttcaattggtcttgatggaactgatgatcggctcatgggaattgttcttaat
gttcctgttacaaagtttagtggcctttggagaagcagacattgggttacgttaagatgt
attcagggggtttggtataatctagacagtgattttattgctccttatgcttttaaagat
acccaacaacttagggagttcttggatcgtatcattactgctggtgctgaggttttactg
gtcatgaatgataaacaatga

DBGET integrated database retrieval system