KEGG   Solanum tuberosum (potato): 102598629Help
Entry
102598629         CDS       T02981                                 

Definition
(RefSeq) putrescine N-methyltransferase 3-like
  KO
K05353  
putrescine N-methyltransferase [EC:2.1.1.53]
Organism
sot  Solanum tuberosum (potato)
Pathway
Tropane, piperidine and pyridine alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    102598629
Enzymes [BR:sot01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.53  putrescine N-methyltransferase
     102598629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 339 aa AA seqDB search
MEVMMNNHNNGTTTNTKIIHKNGSICNGNGNVNGNSHNHNNENKLVEFTNSIKPGWFSEF
SALWPGEAFSLKIEKLLFQGKSDYQDVMLFESTTYGKVLTLDGAIQHTENGGFPYTEMIV
HLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIEKIDIVEIDDVVVDVSRKFFPYLAAGF
DDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV
CTQAESIWLHMHLIKKIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNFKN
PVNSIDKYVKSKGPLKFYNSDIHKSAFILPSFARDLIES
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcatgatgaacaatcacaacaatggcaccaccactaacaccaaaattattcac
aaaaatggaagcatttgcaatggcaatggcaatgttaatggcaactcccacaaccataat
aatgaaaataagcttgtagagttcactaactctatcaaaccgggttggttttctgagttc
agcgcactatggccaggtgaagcattttcacttaaaattgaaaaattactattccaagga
aagtctgattatcaagatgtcatgctctttgagtcaacaacgtatgggaaggtgttaaca
ctggatggggcaattcaacacacagagaatggtggatttccctacactgagatgattgtt
catctcccacttggttccattccatctcccaaaaaggtgttaatcatcggtggagggatt
ggtttcacgttgtttgaggtttctcgttacccaactatcgaaaaaatagacatagttgag
atcgatgacgtggtcgtagatgtatctagaaagtttttcccatacctagcagcaggattt
gatgatcctagagtcactcttattattggcgatggagctgcatttgtgaaagctgctcaa
cctggatactatgatgccattattgttgactcttctgatcctattggtccagcaaaagac
ttgtttgaaaggccattttttgaggcagtagcaaaagccctaaggccaggaggagtagtg
tgcacacaagcagaaagtatttggcttcacatgcatctaattaagaaaattattgcaaat
tgtcgacaagtctttaagggttctgtcaattatgcatggactacagttcctacttaccct
actggtgtaattggttacatgctttgctctacggagggaccagaagttaatttcaagaat
ccagtgaactctattgacaaatatgtcaaatccaagggacctttgaagttctacaactct
gatattcataaatcagcttttattttgccgtcttttgcaagggatttgattgaatcttga

DBGET integrated database retrieval system