KEGG   Solanum tuberosum (potato): 102601489Help
Entry
102601489         CDS       T02981                                 

Definition
histone acetyltransferase HAC1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sot  Solanum tuberosum (potato)
Brite
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102601489
Transcription factors [BR:sot03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102601489
Mitochondrial biogenesis [BR:sot03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102601489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1688 aa AA seqDB search
MNLQHMSGQISGQVPNQSGTSLPGLPQQSGNPFSMQMQNPVVHSNVPNMEPDFSKARIFI
SNKIYEYLMQRQQAHEKPPKKVMDIVKRLEEGLFKSASSKEEYLNPATLENRLHVLIKSL
RMNNQNQRFPRVNSSGSIGTMIPTPGMTPSANSALIGTSSVDSSMAAGSTIASSTGSFLP
MANVSSSGCLTNGYQQPTSNFLVSSGGNNLVPSMSGQRMTSQMIPTPGFNSSCGANLNSN
TSAQSSLSLDSTSSIAALPSVDSMNVSQPLQQKQHVAAQNSRILHTVGSHVGGGIRSGFQ
NRSYGQSTGPLNGGGLGMIGNNLHLVNGSASEGYITATTYGNSPKSLPQHFDQQHQPLMQ
GDRYGISHADTSGSGNLCLPVSSVGMVMNNQKPGAVALQSMSRTNSPLITNQSNLTASGQ
MPNVKVQPVDQSTKMNHQSQHSLGDNHLSSYQHQHSQQPPQQFQEQHQLVQSQPQQKLQN
QQHQTLSRSNAFAQAQLPSDLGIQVKSEPGNHDEAQHSRVNAEQFQFSDIDQFQPNSIED
HSKDAVFQGQWYSKSQDGSQIPGSFSDKQNVQEELCQRTSRKEEAYPNNLCTERSPIGQP
VGNRAVATNNASSSICRFNHLPRERQYFNQQKWLLFLTHARGCSAPEGKCAEKNCIKAQK
LVKHMERCSTFECQYPRCPATRDLINHYRRCRDLNCPVCIPVRKFVRAQQKVARPGCNSD
MPNSANGTCRSYGAGEIASRLTAKQGSVPVQTEDLQFSVKRPKIEQPSQSLIVETENCFM
SVTASESHVTQNAQFIEQHGNAVAMKSEVTDVMMEIPAKAVLVSPRSIDIRNDNLDGTCI
RKPDGDSVVSSNAACLVKQENVKAEKDIDQPKQENTSAPSESTSGSKSGKPTIKGVSMTE
LFTPEQVREHIIGLRRWVGQTKAKAEKNQAMEHSMSENSCQLCAVEKLNFEPPPIYCTPC
GARIKRNAMYYTIGTGDTRHYFCIPCYNEARGDTINVDGTTIPKARMEKKKNDEETEEWW
VQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYIIEVERGERKPLPQSAVLGAKDLPR
TCLSDHIEVRLDKVLKDDRQKRAEREGKSYDEVPGAEGLVVRVVSSVDKKLEVKSRFLEV
FQEENYPLEFPYKSKVLLLFQKIEGVEVCLFGMYVQEFGSECAQPNHRRVYLSYLDSVKY
FRPEIKAASGEALRTYVYHEILIGYLEYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQK
TPKSDKLREWYLSMLRKAVKEKIVVDLTNLFDHFFTTTGECKAKITAARLPYFDGDYWPG
AAEDMIFQLQQEEDGRKHHKKGAMKKTISKRALKASGQSDLSGNATKDILLMHKLGETIS
PMKEDFIMVHLQHACTHCCILMVSGNRWVCKQCKNFQLCDKCYEVEQKLEARERHPLYHK
DIHMLYPTEIDDVPADTKDPDEILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVL
YHLHNPTAPAFVTTCNICHLDIETGQGWRCETCPDYDVCNACYQKDGGVDHPHKLTHHPS
IAERDAQNKEARQQRVLQLRKMLDLLVHASQCRSSHCQYPNCRKVKGLFRHGIQCKIRAS
GGCVLCKKMWYLLQLHARACKVSECHVPRCRDLKEHLRRLQQQADSRRRAAVMEMMRQRA
AEVANSAG
NT seq 5067 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcagcatatgtccgggcagatctcagggcaggttccaaatcaaagtggcact
tctcttcctgggctaccccagcagagtggaaatcctttctctatgcagatgcaaaatccg
gttgtccatagtaatgtgccaaatatggagcctgatttctcgaaagctcggatttttata
tcaaataagatctacgagtatctaatgcagaggcagcaggcccatgagaaacctccaaag
aaggttatggatatagttaaacgcttggaggagggcttgtttaaaagtgcttcatcaaag
gaggagtatttgaatccagcaactttggagaaccggttacatgtcctgattaaaagcctt
cggatgaacaaccagaaccagcgattccctcgtgttaattcttctggctccattggtaca
atgataccaaccccaggcatgacaccaagtgcgaattcagctctgattggaacatcatct
gttgacagttccatggctgctgggagtaccattgcatcctctactggaagcttcttgcca
atggctaatgtgtcttccagtgggtgtttgacaaatggatatcaacagccaacttccaat
ttcttggtcagttcgggtgggaataatttggtaccatcaatgagtgggcaaagaatgaca
agccaaatgatccccactcctgggtttaattccagttgtggtgctaatttgaatagcaac
actagcgcacagtcttccctgagtttggactcaaccagtagtattgctgcacttcctagt
gttgattccatgaatgtttcacagcctctgcaacaaaagcagcatgttgctgctcaaaac
agccgtatactgcatacagttggcagccatgtgggtggtggaatcaggtccggatttcag
aatagatcctatggacagtcaactgggcctctgaatggagggggacttggaatgattgga
aacaatttgcacttggtgaatggttcagcatctgagggctatataacagcaaccacgtat
gggaactccccaaagtcattgccgcagcattttgatcaacagcatcaaccattaatgcaa
ggtgatagatatggtatcagtcatgcagatacttcggggtctggaaacttgtgtcttcct
gtttcttctgtgggaatggtcatgaataatcaaaaaccgggtgctgtagccttacagtcc
atgtccagaacaaactctccgttgattaccaatcagtcaaacttgactgcctctgggcaa
atgccaaatgtaaaggttcaaccagttgatcagtcaacgaagatgaaccatcagtcccag
cattcactgggagataaccatttatcttcctatcagcatcaacatagtcaacagccgcct
cagcagttccaggagcaacatcaacttgttcaatctcaaccccaacagaagctgcaaaat
cagcagcaccaaactttgtcaaggagcaatgcttttgctcaagctcagctaccttctgat
cttggtattcaggtaaagtctgagcctggaaatcatgatgaagctcaacattcccgggtc
aatgctgagcaatttcagttctctgacatagatcagtttcagccaaattctattgaagac
cattctaaagatgcagtatttcagggtcaatggtattccaagtcacaagatgggagtcaa
ataccgggtagcttctcagataagcaaaatgtgcaagaggagttgtgtcagagaacttcc
aggaaagaggaagcttatccaaataatttatgcactgagagatcaccgatcggtcaacct
gttggtaatagagcagttgccaccaataacgcaagcagctccatctgcagatttaatcac
cttcctcgtgaacgacagtatttcaatcagcagaagtggctattgtttttgactcatgca
cgtggatgttctgctcctgaagggaaatgtgcagagaagaattgcataaaagctcaaaaa
cttgtgaagcatatggaacgatgcagcacctttgagtgtcaatatcctcgttgccctgca
acaagagacttaattaatcactatagacgttgcagagatctaaactgtcctgtttgcatt
cctgtcaggaaatttgtacgggcacaacagaaagttgctcgtcctggctgcaattctgat
atgccaaattctgctaatggtacttgtagatcctatggtgccggtgaaattgcttccagg
ttgactgccaagcagggttcggtgccagttcaaacagaagatttacagttttctgttaag
cggccgaagattgagcaaccttctcaatctcttatcgtggaaactgaaaattgttttatg
tcagttaccgccagcgagtctcatgttacccaaaatgcccagttcattgaacagcatggc
aatgctgtggcaatgaaatctgaagtcactgacgtaatgatggaaattcctgctaaggct
gtgctagtcagtcccaggagtattgacatacgaaatgacaatttggatggtacctgcatt
cgaaagcctgatggtgattctgttgtatcaagtaatgcagcttgtcttgtgaaacaggaa
aatgttaaggctgagaaggacattgatcagcctaaacaggaaaatacgtcagcaccctct
gaaagcaccagcggatctaagtctgggaagcctacaataaagggtgtatcaatgactgaa
ttattcaccccagagcaagtccgagaacacattattggtctgaggcgatgggttggccag
accaaagcaaaagcagaaaaaaatcaagcaatggaacattccatgagtgaaaattcatgt
caattatgtgcagttgagaagctaaattttgaacctccacctatatattgtactccatgt
ggtgctcgtattaaacgaaatgcaatgtattataccattggaactggtgatactagacac
tacttttgcattccatgctataatgaggctcgtggagacaccattaatgttgatgggacc
actattccgaaggcgaggatggagaaaaagaaaaatgacgaggaaactgaagaatggtgg
gttcaatgtgataagtgtgaagcttggcaacatcagatttgtgcattgttcaatggtagg
aggaatgatggtgggcaagctgagtatacctgtcccaattgttatattatagaggttgaa
agaggtgagcgtaagcccttaccacagagtgctgttcttggagccaaagatctgcctcgc
acatgtctcagtgatcatattgaggttcgattagataaggttttgaaggatgatagacaa
aaaagagcagaacgtgaaggaaaaagttatgatgaggttcctggtgctgaagggcttgtt
gtaagagttgtgtcatcagtagacaaaaagttagaagtgaaatcaaggtttcttgaggtc
tttcaagaagagaactatccgctggagttcccatataaatcaaaggtgttattgttattt
cagaaaattgagggtgtagaagtgtgcctctttggcatgtatgttcaggaatttggatct
gaatgcgcacaaccaaatcatcgccgtgtttatctctcgtatctagattctgtcaaatat
ttcaggcctgagatcaaagctgcatctggcgaggctcttcgcacatatgtgtaccatgaa
attttgattggatatttagaatattgcaaaaagcgtggtttctcaagttgctatatatgg
gcttgtcctccactgaagggtgaagattatatattatattgccacccagaaatccagaaa
accccaaaatctgacaaactcagagagtggtatttatcaatgttaagaaaagctgtgaag
gaaaagattgttgtggatctcacaaatttatttgaccacttcttcaccaccacgggtgaa
tgtaaagctaaaatcactgcagctcgcctgccctattttgacggagactattggcctggt
gcagcagaggatatgatttttcaacttcaacaagaagaagatgggaggaaacatcataag
aagggggctatgaagaagaccatatcaaaaagagctcttaaagcatctggtcaatctgat
ctttctggaaatgcgactaaggatatacttctaatgcacaaacttggtgaaactatttct
ccaatgaaggaagattttattatggtccatttgcagcatgcgtgtactcattgctgtatt
ctgatggtatccggtaatcgttgggtatgcaaacaatgcaagaactttcagctttgcgac
aagtgctatgaagttgagcaaaaactcgaagccagagaaaggcatcctctctatcacaag
gacattcatatgctttatccaactgaaattgatgatgtacctgctgataccaaggatcca
gatgaaattcttgagagtgaattttttgatacaaggcaggcatttttgagcctttgtcaa
ggaaaccattaccaatatgataccctgcggcgtgctaaacattcctcaatgatggtcctt
taccaccttcataatcccactgcaccagcatttgtgacaacttgcaatatttgtcatctt
gacatagaaacaggtcaaggttggcggtgtgaaacttgccctgattatgatgtatgtaat
gcttgctatcagaaggatggtggagttgatcatcctcacaagttaactcatcacccatcc
attgctgagcgtgatgctcagaataaagaagctagacaacaacgagttctgcagcttagg
aagatgcttgaccttttggtgcacgcatctcagtgccgctcttcccattgtcaatatcca
aactgtcggaaagttaaggggcttttccgccatggtatacagtgcaaaatacgtgcttca
ggaggttgtgttctctgtaagaaaatgtggtatcttcttcaactccatgcccgtgcttgc
aaagtatctgagtgtcatgtgccacgatgcagagatttgaaagaacatcttcggaggctg
caacagcaagctgattctcggcggcgggctgctgttatggagatgatgagacagcgtgct
gcagaggttgcaaacagtgctgggtga

DBGET integrated database retrieval system