KEGG   Solanum tuberosum (potato): 102603323Help
Entry
102603323         CDS       T02981                                 

Gene name
PEPC, PEPCase, PPC1, ppc
Definition
phosphoenolpyruvate carboxylase-like (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sot  Solanum tuberosum (potato)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102603323 (PEPC)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102603323 (PEPC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102603323 (PEPC)
Enzymes [BR:sot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102603323 (PEPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 965 aa AA seqDB search
MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK
LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYSQIEDLMFELSMWRCNEELRVRADDLQRSSRRDEKHYIEFWKQV
PPNEPYRVILGDVRDKLYQTRERARQLLGHGYSEIPEEATYTNIEQFLEPLELCYRSLCA
CGDLSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLEIGSYRDWSEER
RQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFHVIAELPADCFGAYIISMATAPSDVLA
VELLQRECRVRQPLRVVPLFEKLADLDAAPAAVARLFSIEWYRNRINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIQVAKEFDVKLTMFHGRGGTVGRGGGPAHLAILSQPPETIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEIAVVAT
EKYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAALFD
KLLVSEDLWSFGELLRSKYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNVCQ
AYTLKRIRDPDYSVTPRPHISKEYMEAKPATELVNLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgactactaggaatttggacaaacttgcatcgattgatgcacagttgaggcaattggtg
cctgctaaagtttctgaagatgataaacttgttgagtatgatgctttgcttttggatagg
tttcttgatattcttcaagatttacatggggaggatctcaaagaaacagtccaagagtgt
tatgagctttctgccgagtatgaagccaagcatgatccgaagaagctggaggaacttggc
aatgtgttgacaagtttggacccaggagattcaattgtcattgctaaagctttctctcac
atgcttaacttggccaatttggctgaggaggttcagattgcctaccgtaggcgccaaaaa
ttgaagaaaaagggagattttggggatgagagcaatgcaacaactgagtcagatattgaa
gaaactttcaagaaattggtgggggacttgaagaagtcccctcaagaagtttttgatgct
atcaagaatcagactgtggatctggtcctaacagctcatcctacacaatctgtacgaaga
tcattgcttcaaaagcatggaaggatccgtgactgcttggctcagttgtatgctaaagac
atcacacccgatgataaacaagaacttgatgaggctttacagagggagatccaagctgcg
ttccgaactgatgagatccgaagaactcctcctactccacaagatgaaatgagagctgga
atgagctatttccatgaaacaatttggaagggtgtaccaaagtttctgcgccgtgttgat
acagctcttaaaaacatagggattaatgaacgagttccttataatgctcctcttattcaa
ttctcctcttggatgggcggtgatcgtgatggtaatccaagagtgactcctgaggtcaca
agagatgtttgcttattggccagaatgatggcagctaacttgtactattcgcaaatagag
gacctcatgtttgagttatctatgtggcgctgcaatgaagaacttcgtgtgcgagcagat
gatctccaaaggtcttcaaggagagatgaaaaacactacatagaattttggaagcaagtt
cctccaaatgaaccctatcgtgtaattcttggtgatgtgagagataagttgtatcagaca
cgtgagcgtgctcgccaactgttaggccatggatactctgaaattccagaggaagcaact
tatactaatattgagcagttcttggagcctcttgagctctgctacagatctctttgtgct
tgtggtgacctctccatcgcggatggtagccttctggatttcctgagacaagtttctacg
tttggactttcacttgtgagacttgacataagacaagagtcggaccgccatactgatgtg
cttgacgctattacgcaacatttggaaattggttcatatcgagactggtctgaagaacgt
agacaagagtggcttctgtctgaactcagtggcaagagacctttatttggacctgatctt
ccaaaaactgaagaaattgctgatgttttggataccttccatgtcatagccgaactccca
gcagactgcttcggggcatacatcatctcaatggccactgcaccatctgatgttcttgca
gtagagcttctacagcgtgaatgccgagtgaggcaacctttacgagttgttccacttttt
gagaagttggctgatctggatgctgctcctgcagccgttgcacgtcttttctcaattgag
tggtacagaaaccggattaatggcaagcaagaagtgatgattggatactccgactctggc
aaggatgcaggtcggctatcagcagcctggcagttatataaggctcaagaggagcttata
caagtcgccaaggagttcgacgtgaagctaaccatgttccatggtagaggtggtacagtg
ggaagaggaggtggccccgcccatcttgccatattgtctcaaccacccgaaacaattcac
ggatctctccgtgttacagttcagggtgaggttattgagcagtcttttggggaagaacac
ttgtgttttaggacactccagcgttttactgctgctacacttgaacatgggatgcatcca
ccagtctctccaaaaccagaatggcgtgcacttatggacgaaattgcagttgttgcaaca
gaaaagtatcgatcaatagtttttaaggaaccccgatttgtcgagtatttccgcctggcc
acacccgagttagagtatggtcgaatgaacattggcagccgtccatcaaagcgtaaaccc
agcggaggcatagaatcacttagagctattccgtggatctttgcttggactcaaactaga
ttccatcttccagtctggctcggctttggagcagcatttaagtatgccattgaaaaggat
atcaaaaaccttcgcatgctgcaggaaatgtacaatgcatggcctttctttagggtaact
attgatttggttgagatggtgttcgccaaaggagacccaggcattgctgcattgttcgac
aagcttctggtgtccgaagatttgtggtctttcggtgaacttttgaggtcaaagtatgag
gagacaaagagcctcctcctgcagattgctggacacaaggatcttctggagggtgatcca
tacttaaaacaacgactcaggttgcgtgactcctacatcacaacattgaacgtgtgtcaa
gcctacaccctaaagcgtattcgtgacccagactatagtgtcacaccaaggcctcacatt
tccaaggaatacatggaagcaaaaccagctacagaacttgtgaacctgaacccgactagc
gaatatgcacctggcttggaggacacactcatcttaaccatgaaaggtattgctgctgga
atgcagaatactggttag

DBGET integrated database retrieval system