KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_0078Help
Entry
Spy49_0078        CDS       T00780                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spy49_0078
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spy49_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87367..87615
Genome map
AA seq 82 aa AA seqDB search
MCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGSDVPYCLLSGCAQVTGKGEVV
CRIWGLLSSWVVLVKPDFGIST
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
ttatggctccttactcttagccgaaaagatatgatggatattggtataccgattggtagt
gatgtgccttattgcttgctttcaggttgtgcccaagtcactggtaaaggtgaagtggtt
tgtcgcatttgggggctgttatcgtcttgggtggttttggttaaaccagattttggtatc
tcgacttga

DBGET integrated database retrieval system