KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_0191cHelp
Entry
Spy49_0191c       CDS       T00780                                 

Gene name
hasC.2
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00040  Pentose and glucuronate interconversions
soz00052  Galactose metabolism
soz00500  Starch and sucrose metabolism
soz00520  Amino sugar and nucleotide sugar metabolism
soz01100  Metabolic pathways
soz01130  Biosynthesis of antibiotics
Module
soz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spy49_0191c (hasC.2)
   00052 Galactose metabolism
    Spy49_0191c (hasC.2)
   00500 Starch and sucrose metabolism
    Spy49_0191c (hasC.2)
   00520 Amino sugar and nucleotide sugar metabolism
    Spy49_0191c (hasC.2)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spy49_0191c (hasC.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACI60535
UniProt: A0A0H3BWN0
Position
complement(200734..201633)
Genome map
AA seq 299 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKS
KRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTFV
GNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQA
KAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDT
LNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKTYIIQLGKALEKTKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgctttttacct
gcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaattt
atcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaatcc
aaacgctccatagaagatcattttgattctaattttgaattagaatataatttacaggct
aaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatcttcacttt
attcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacctttgtt
ggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaatccaaat
gtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaaccatt
gccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcctcaagca
aaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaagat
gcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagtatt
ttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgatacc
ctcaataaaacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgtcggc
gataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtcaaa
gatgacttgaaaacctacatcatccaactgggcaaagcactagagaaaacaaaaccataa

DBGET integrated database retrieval system