KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_0865cHelp
Entry
Spy49_0865c       CDS       T00780                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.38)
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spy49_0865c
Enzymes [BR:soz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Spy49_0865c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(864388..865437)
Genome map
AA seq 349 aa AA seqDB search
MKAATYLSTGNLQLIDKPKPVIIKPTDAIVQLVKTTICGTDLHILGGDVPACKEGTILGH
EGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCEDGGWILGHLINGTQA
EYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKPGDNVCIVGAGPVGL
AALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKAIIDDITNGRGVDIS
MECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNITLNTGLVNGNTTEML
LNVLKTGKIDATRLITHHFKLSEVEKAYETFKHAGANNALKVIIDNDIS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacttacctttcaaccggaaatctacagctcatagacaaaccaaaacca
gtcattataaagcctacagatgctatcgtccagttggtaaaaaccactatttgtggaact
gatttgcatatcttaggtggggatgttcccgcatgtaaagaaggaacaatccttggtcat
gaaggaattggaattgttaaggaggtcggtgatgcggttactaactttaaaatcggagat
aaagtgattatttcttgcgtcacatcatgtcatacctgttattattgtaaacgaggcctt
tcgtcacattgtgaagatggcggttggattcttggccatttaattaatggaacacaagca
gaatatgtccatatcccacatgcagatggtagtctctatcatgctcctgatacgattgat
gatgaggcacttgtcatgctttctgatattttaccaacttcatatgaaattggtgtcttg
ccatcacatgtcaagcctggagataatgtttgtattgttggtgccggtccggtaggactc
gcagccctactaaccgttcaatttttctctccagccaatattattatggtcgacttatct
caaaatcgccttgaagcagctaaaacgtttggagccacacacacgatttgttcaggaagt
agtgaagaagtcaaggctatcattgacgatataaccaatggacgtggtgtcgatatttcc
atggagtgtgttggttatcccgcgacatttgatatttgtcaaaaaattatatcagtaggt
gggcatattgctaacgttggggttcatgggaaaccagttgatttcaacctggatgaatta
tggattaaaaatatcaccttaaacactggacttgttaatggcaatacaactgaaatgcta
ctaaatgtcttgaaaactggaaagattgacgcaacaagacttattacacatcattttaaa
ctttcagaagttgaaaaagcttatgaaacctttaaacatgctggtgcaaataacgccttg
aaagttattattgataatgatattagctaa

DBGET integrated database retrieval system