KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1018cHelp
Entry
Spy49_1018c       CDS       T00780                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00010  Glycolysis / Gluconeogenesis
soz00030  Pentose phosphate pathway
soz00051  Fructose and mannose metabolism
soz00052  Galactose metabolism
soz00680  Methane metabolism
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01120  Microbial metabolism in diverse environments
soz01130  Biosynthesis of antibiotics
soz01200  Carbon metabolism
soz01230  Biosynthesis of amino acids
soz03018  RNA degradation
Module
soz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spy49_1018c (pfk)
   00030 Pentose phosphate pathway
    Spy49_1018c (pfk)
   00051 Fructose and mannose metabolism
    Spy49_1018c (pfk)
   00052 Galactose metabolism
    Spy49_1018c (pfk)
  Energy metabolism
   00680 Methane metabolism
    Spy49_1018c (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spy49_1018c (pfk)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spy49_1018c (pfk)
Protein phosphatases and associated proteins [BR:soz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spy49_1018c (pfk)
Messenger RNA biogenesis [BR:soz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spy49_1018c (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACI61318
UniProt: B5XLV6
Position
complement(1012317..1013330)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggcgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatttcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagaatttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgagggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgctggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagcggtgaagcttttgctcaaaaactgaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggtcacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system