KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1049cHelp
Entry
Spy49_1049c       CDS       T00780                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spy49_1049c
Enzymes [BR:soz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Spy49_1049c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048492..1049892)
Genome map
AA seq 466 aa AA seqDB search
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL
IVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEPIVPVECGY
LGYYHYPCKVDAKAAVQVAYNTQLPSSLAVKACHKLHPDHKISIVLNMTPAYPRSNAPED
VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN
YYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALNLKEHY
GNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaaaacaccgttatcaatttccagatggctttttatggggaagttccaca
tctgggcctcaaagcgaaggaacggttcctggagatggcaaaggacctagcaactgggat
tactggtttagtattgagtcagctaagtttcatcaccaaattggtccagaaaaaacctca
accttttatgaaaactataagggtgacattgcccttttgaaagaaacaggccacacgatt
tttcggacctcaatccagtggtctcgattgattccagaaggagtcggggaggttaatcca
aaggcggtgacattttatcgagaagtatttcaagacattattgctcaaggtattaaattg
attgttaacctctatcattttgacctcccctatgccttgcaagaaaaaggtggctgggaa
aacaaagctactgtctgggcttatgaaacctacgcaaaaacctgttttgagctttttggt
gatttagtaaacacttggattacctttaatgaaccgattgttccagtcgaatgtggctat
ttaggttattatcactacccttgtaaagtagatgccaaggcagcagttcaagtggcttac
aacacacaactgcccagttcactggcggtcaaagcttgtcataagcttcatcccgaccac
aagattagtattgtgcttaacatgacacctgcttatcctcggagtaatgctcctgaagat
gtcaaggctgctagaatcgcagagcttttccaaaccaaatccttcctagatccatcagtt
ttgggtgtttacccagcagagttagtttccattttagaggaagctgatttattacctcaa
tatagtgctgatgaattagagattatcaaaaacaatactgttgattttttgggagttaat
tattatcagcctttgcgggttcaggcacctagtaagtcacagcaagagggggaccccctt
atcttagatatttattttgaaccttatgatatgcctggtaaaaaagtcaatcctcaccgg
ggttgggaaatttatgaaccaggactttatgatattgcccttaatttaaaagaacactat
ggtaacatcgaatggctagtcacggaaaatggtatgggtgtcgaaggtgaagaagctttt
ttagcagatggccagatacaagatgactaccgcatcacctttatcgaggatcatcttatc
cagcttcataaggctttgggagaaggagccaactgcaaaggctacctcttgtggactttt
attgattgctggtcttggttaaatgcttataaaaaccgatatggtttggtagctttggat
ttagagagtcaaaagcgaaccataaaaaaatcaggttactggtttaaggcgttgagcgag
tcaaatggttttgataaatag

DBGET integrated database retrieval system