KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1114cHelp
Entry
Spy49_1114c       CDS       T00780                                 

Definition
(GenBank) Putative 16S pseudouridylate synthetase
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Enzymes [BR:soz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     Spy49_1114c
Ribosome biogenesis [BR:soz03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Spy49_1114c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ACI61406
UniProt: A0A0H3BYY6
Position
complement(1111245..1111961)
Genome map
AA seq 238 aa AA seqDB search
MRLDKLLEGTKVGSRSQVKKLIKAQGVWVDHMLARNGRQNVDPGLQLIEVTGQRVTHPKH
SYIILNKPSGVVSAKKDTNYLTVIDQLAEEDKSPDLYPVGRLDRDTEGLVLLTDNGPLGF
RMLHPSHHVSKTYLVTVNGLLAEDASDFFAAGICFPTGEQCQPAQLTILKADTDQSQASL
TISEGKFHQVKKMFLTYGLKVTSLKRTHFAGLELGHLASGEYRYLTASERQLIKTYLD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttagataaattattagaaggtacaaaagttggctctagaagtcaagtgaagaaa
ctgattaaggctcaaggggtttgggttgatcacatgcttgccagaaatggtcgacaaaat
gttgatcctggcttgcaactgattgaggtgactggacagcgagtgacgcatcctaaacat
tcttacattatcctcaacaagccatcaggggtggtctcagctaagaaagatactaactat
ttaaccgttattgatcagcttgctgaagaagataaaagtccagacttgtatcctgttggc
agattggatagagataccgaagggttggttttactcactgataatggtcccctagggttt
cggatgttgcaccctagtcatcatgtttctaaaacgtatcttgtaaccgttaatggcttg
ttagcagaagatgcctcagatttttttgcagctggtatttgtttcccaacaggtgaacaa
tgccaaccagctcaattgactattcttaaagccgatacagaccagtcacaggctagtttg
accatttcagaaggaaaatttcaccaagtgaaaaaaatgtttttgacctatggtttgaaa
gtgacctctctgaaacggacgcactttgcagggctggaactcggtcatttagccagcgga
gaatatcgttatctaacagcgtcagaaaggcaactcattaaaacgtatctggactga

DBGET integrated database retrieval system