KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1117Help
Entry
Spy49_1117        CDS       T00780                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1114021..1115241
Genome map
AA seq 406 aa AA seqDB search
MKLLGKWLFFLMFLTFCVSFWQKDYQRIAFEKEHKLYQDLVAPFYQNYPKLRELQLSEAI
KLRHDLLDYVRKLDKDGWSYKAIQKGYLEQLAVRGNSYHFEQLYSRIRLIGSPDFQKLWQ
QEEMAQTPQEAQKRLQLLLTYLKMPDELTGQSKQTQQVLAQLSPKLSPTDPFWDQLSALI
QACYVNLEHIPYSRFNRKIHQLRYLISTQQMEWVRSHYGNKGKTDADALAKYLATLEDDD
YALYESSRYHNKVASILDANGNHQAVYTDNIPQTNYKILIHFHSEFILSESGQFLVALDP
DNLTRNSIVNGSSFNYGNQNDDLHRLLDIDPILLFDPAFIEKAINSPDATFLVPDLEQQR
DKHNPIYSRNGKSSKQLTRAAVKKFKKLLHHYQEIRGDNKTSKTQH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacttggaaaatggctattcttcttgatgtttctgactttttgcgtcagtttt
tggcagaaagactatcagcggattgcctttgaaaaagaacacaaactttatcaagattta
gtggcacctttttaccaaaactatcctaaattacgagaactccagctttcagaagctatt
aaattacgccacgacttgcttgattatgttcgaaaactcgataaggacggatggtcctat
aaagccatccaaaaaggataccttgaacaactcgctgttagaggaaactcttatcatttc
gaacaactttatagtcgcattcgcctgataggatcacctgactttcaaaagctctggcaa
caagaagagatggcacagacgcctcaagaagctcaaaaacggctacagctgctcttgacg
tatttaaagatgccagacgagttgacaggacaatcaaaacaaacacagcaagtattggca
caattaagtccaaagctatcgccaacagatcctttttgggaccaattatctgccctgatt
caggcttgttatgttaatctcgaacacattccttatagccgttttaatcggaaaattcat
caactccgttacctcatatcaacccagcaaatggagtgggttcgctcacattatgggaat
aaagggaaaaccgatgcggatgccttagccaaatatttggctactctagaagatgacgat
tatgctctttatgaatcttctagataccataataaggttgctagtattttagatgctaat
ggcaatcatcaggcagtctatacagacaatattcctcaaaccaactataagattttgatt
cattttcactcagagtttattttgtcagaatctggacaatttttagtagcactagatcct
gataacctaacgcgaaatagtattgtcaatggttcttctttcaattatggcaaccaaaac
gatgacttgcaccgtctgcttgatattgaccctattctgctttttgatccggcttttatt
gaaaaagcaattaatagtcctgatgcaacttttctagttcccgatttagaacagcaaagg
gataagcacaatcccatttacagcagaaatggcaaatcatctaagcagctaacacgcgct
gccgttaaaaaattcaaaaaattgcttcaccattatcaagaaataagaggtgacaataag
acctcaaaaacacagcattaa

DBGET integrated database retrieval system