KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1120cHelp
Entry
Spy49_1120c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1115942..1116190)
Genome map
AA seq 82 aa AA seqDB search
MDADLVQMDALGLYYDDNHLSLVNTVKAYLKEFGIGESQIAFSYKGLNSGRTAAMNDHQP
MIAGSTYKLPLNMLVVDKANYP
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagatttagtgcaaatggatgccttagggctctattacgatgacaaccatttg
agtttggtcaatacggtcaaggcatatttaaaggaatttggcattggtgaatcccaaatt
gccttttcctacaaaggcctcaattcaggcaggactgctgccatgaatgaccatcagcca
atgattgcaggaagcacctataagctgccattaaacatgctggtggtagataaggcaaat
tatccatga

DBGET integrated database retrieval system