KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1124cHelp
Entry
Spy49_1124c       CDS       T00780                                 

Gene name
comEC
Definition
(GenBank) DNA internalization-related competence protein ComEC/Rec2
  KO
K02238  
competence protein ComEC
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:soz02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   Spy49_1124c (comEC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1118376..1120619)
Genome map
AA seq 747 aa AA seqDB search
MTFSWTKLVPLSKIQFAFLILVLFYQIHSPSWLTFLLSLSLICLLVKRLSKKEFLGVFAI
LSFCSLFLLYQKQQLVQKLEIQPVQITSVALVPDSIRINGDQLAVLGRYGKHSYQLFYRL
KSQAEAQLFKKEHRWLVMHAKVTLEKAEEVRNFKGFNYQTFLAYQGIYRIGKVEQIEQLE
VISPESICDYLSSLRRRAIVHCQQHFPRPMSHYLTGLLFGYLDKSFGEMTDYYSQLGIIH
LFALSGMQVGFFLTCFRRVLLLLAVPLEWIKWIELPFACFYAALTGYSICVIRSLVQSQL
RHLGIKGLDNLACTFLLVFLWDAHFLMTVGGVLTFSYAFLLTVVTVEELSGAKRQLVQVL
TISLGILPFLLFYFSSFNPMSMVLTALLSYLFDLFILPLLCLVFCLSPLVTVSICNHLFI
LLEKVIQFLGNTFNSSLVFGSPTSWHLLILVISFAIFYDYRQVRQRVITCGLVIALTLLS
VKYPLTNEVTFIDIGQGDSILVREWTGKNLLIDVGGRPFFSSKEHWRRGHHVANAQKTLI
PYLKSRGIHTIDQLLVTHADTDHMGDIEVVAKAIRIKEILTSQGSLSHPSFVRRLRRLKC
HVRVLAAGDQLPIMGSVLQVLYPWQLGDGKNNDSLVLYGRLLNRTFLFTGDLEKEGENEI
IKRYPQLRVDYLKAGHHGSNTSSSAAFLDHIQPKVAFISAGKNNRYQHPHRETLARLEDR
QITYYRTDTQGAIRLTGRTSWHLETVR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcttggactaagctagtgcccctgtcaaagattcaatttgcttttttaatc
ttggttctcttttatcaaatccatagccctagctggttaacgtttctccttagccttagt
ttgatttgcttacttgtcaagcgtttgtctaaaaaagaatttctcggtgtctttgctatc
cttagtttctgttctttgtttttgctgtatcagaaacagcagttggttcaaaaactggaa
attcagccagtacaaataacctctgtagcattagttcctgatagtattcggattaatggt
gatcaattagctgttcttggacgttatgggaaacattcttatcagttattttaccgtttg
aaaagccaagcagaagcccaattgttcaagaaagagcaccgttggttagtgatgcacgca
aaagtgacattggaaaaagctgaggaagttcgaaattttaaaggctttaattatcagact
tttttggcttatcaaggaatttacaggatagggaaggtagagcaaatagaacagcttgaa
gtgatttcacccgagtcaatatgtgactatttgtcctctttaagacggcgagccattgtt
cattgccagcagcattttccaagacctatgtctcactacctgacgggcctcctttttggt
tatttagataagtcgtttggtgagatgacagattattatagtcagttgggtatcattcat
ctctttgctttatcagggatgcaggttggcttctttctcacttgttttagaagggtgttg
ctattactcgcagttcctttggaatggataaaatggatagagcttccttttgcttgcttt
tatgccgcgttgacaggttatagtatttgtgttattcgaagcctcgtgcagtcgcagttg
cgtcatttaggaataaaaggattagacaatctggcttgtacttttttacttgtcttttta
tgggatgcccatttcttaatgactgttggtggcgtattaacgtttagctatgcttttttg
ttaacagtggttactgttgaagaattatcaggagctaaaagacagttggtacaagtcttg
accatttccctaggaatattaccatttttgctcttttatttttccagttttaacccaatg
tcaatggtcttaacagctctcttgtcttatctctttgacctttttattttgccccttctt
tgtctggttttttgtctatcccctttggtgactgtctcaatatgcaaccatctttttatt
ttattagaaaaagtcattcaatttctcggaaatactttcaatagttcccttgtttttgga
agcccgaccagttggcacttgcttatcttggtgattagcttcgctattttttatgattat
cggcaggtgcgacaacgagttatcacttgcggtttggttatagcgttgacgcttttgtct
gtcaaatatcctttgaccaatgaagtgacctttatcgacattggccagggagatagtatt
ttggtgagggagtggacagggaaaaatctcttaatagatgtaggtgggcgccctttcttt
tcttcaaaagagcactggcgacgaggacatcacgtagctaatgctcagaaaaccttaatt
ccttacttaaaaagtagaggtattcacacaattgaccaactattagtaactcacgcagat
actgatcatatgggggatatcgaagtggttgccaaagctattcggataaaggagattttg
actagtcaaggcagtttaagccatccaagctttgttaggcggctaaggcgtttaaaatgt
cacgttagggttttagcagctggagaccagttgcctattatgggaagtgtcttacaggta
ctctacccttggcagttaggggacgggaaaaataacgattctttggtactttatggcagg
ctcttaaatcgaacttttcttttcacaggtgacttggaaaaagagggggaaaacgagatc
ataaaacgttatcctcaactaagagtagattatttaaaagcaggtcaccatggatcaaat
acctcttctagtgcagcttttttagaccatattcagcctaaagttgcctttatttctgct
ggaaaaaataaccgttatcagcatcctcacagagaaaccttagcccgtttggaagacaga
caaatcacttattaccgaacggatacgcaaggagctattcgtttgactggtcggacaagc
tggcatcttgaaacggtccgttag

DBGET integrated database retrieval system