KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1127cHelp
Entry
Spy49_1127c       CDS       T00780                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
  KO
K00655  
1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spy49_1127c
   00564 Glycerophospholipid metabolism
    Spy49_1127c
Enzymes [BR:soz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Spy49_1127c
Lipid biosynthesis proteins [BR:soz01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Spy49_1127c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1121462..1122202)
Genome map
AA seq 246 aa AA seqDB search
MFYAYLRGLVVFLLWVVNGNAHYHHEEKMLDASENYILVAPHRTFWDPVYMAFAARPKQF
IFMAKKELFANRLFAWWIKMCGAFPIDRDKPSPDAIRYPVNMLKKSNRSLLMFPSGSRHS
QEVKGGVAVIAKMAKVKIMPAAYQGPMSVKGLLAGERVDMTFGNPIDVSDIKRMNDEGIA
EVANRIQAEFDRMDDELAPFQPGKARNPLTYLYRLPLGLVLVVVLLLTMLFSYIASFVWN
PDKHRH
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgttttacgcttacttacgaggtttagtagtctttttattatgggttgtcaatggcaat
gcccactaccatcatgaagaaaagatgttagatgcttctgagaattatattctggtagca
ccccatcgaaccttttgggatccagtttacatggcatttgcagcacgtcctaagcagttt
atttttatggctaaaaaagagttgtttgcaaatcgtctctttgcttggtggattaaaatg
tgtggtgcttttcctattgatcgtgacaaaccgagtccagatgctattcgttaccctgtt
aatatgctcaaaaagagcaatcgttctcttcttatgtttccaagtggaagtaggcattcg
caagaggtcaaaggaggggtcgctgtgattgctaaaatggctaaggtcaagattatgcca
gcagcctatcaggggcctatgtcggttaagggattactagcgggagaacgggttgacatg
acttttgggaatcccattgacgtctcagatattaaacgcatgaatgatgaagggattgct
gaggtggcaaaccgtattcaggcagagtttgatcggatggatgacgagttggcacctttc
caaccaggcaaagcaaggaaccctttaacttatctctaccgtttaccattaggattggtt
ttggtggtggtattattattaaccatgttattttcctatattgctagttttgtttggaat
ccagataaacatcgccattaa

DBGET integrated database retrieval system