KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1130cHelp
Entry
Spy49_1130c       CDS       T00780                                 

Gene name
kup
Definition
(GenBank) Potassium uptake protein, putative
  KO
K03549  
KUP system potassium uptake protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Transporters [BR:soz02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Spy49_1130c (kup)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1123388..1125388)
Genome map
AA seq 666 aa AA seqDB search
MSDSHLTAFDKASKAGFIIALGIVYGDIGTSPLYTMQSLVENQGGVNQVSESFILGSISL
IIWTLTLITTIKYVLIALKADNHHEGGIFSLFTLVRKMSPWLIIPAMIGGATLLSDGALT
PAVTVTSAIEGLKAVPGLSHIYQNQTNVIITTLVILIVLFGIQRFGTGFIGKIFGPVMFI
WFSFLGVSGFFNTLGHLEIFKAINPYYALHLLFSPENHRGIFILGSIFLATTGAEALYSD
LGHVGRGNIYVSWPFVKMCIVLSYCGQAAWILANKHSGIELNPFFASVPSQLRVYLVSLA
TLAAIIASQALISGSFTLVSEAMRLKIFPLFRVTYPGANLGQLYIPVINWILFAVTSCTV
LAFRTSAHMEAAYGLAITITMLMTTILLKYYLIKKGTRPILAHLVMAFFALVEFIFFLAS
AIKFMHGGYAVVILALAIVFVMFIWHAGTRIVFKYVKSLNLNDYKEQIKQLRDDVCFDLY
QTNVVYLSNRMQDHMIDRSILYSILDKRPKRAQVYWFVNVQVTDEPYTAKYKVDMVGTDY
MVRVNLYLGFRMPQTVPRYLRTIVQDLMESGRLPKQEQEYTITPGRDVGDFRFVLIEERV
SNARQLSNFERFIMHTKASIKHVTASPMRWFGLQYSEVTLEVVPLILSDILKLPIKELVP
VEDSEA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatagccatcttactgcctttgacaaagcttcaaaagcaggttttattattgct
ttaggtattgtttatggagatattggaacaagccccctttatacgatgcagtctctagtt
gaaaatcaaggaggggttaatcaggtttctgaatcctttattttaggatcaatctcttta
attatttggacactgaccttaatcacaacaatcaagtacgttttgattgctctaaaagcg
gataaccaccatgaaggtgggattttttctttattcaccttggtacgtaaaatgtcaccg
tggctcattattccggcgatgattggaggtgcaacacttttgtctgatggggctcttaca
cctgcggtaacagttacttcagctattgagggcttgaaagccgttcctggtctgagtcac
atctaccaaaatcaaaccaatgtcattatcacaactctagtgattttaatagtcttgttt
ggtattcagcggtttggaacaggttttattggtaaaatttttggaccagttatgtttatc
tggtttagttttctaggtgttagtggtttttttaatacgttggggcatctggaaattttc
aaggctatcaatccttactatgctctgcatttgctgtttagtcctgaaaaccatcgtggg
atttttatcttggggtccatttttcttgcgacaacaggagctgaagccctttattcggat
ttaggacatgttggtcgaggaaatatttatgtgagctggccctttgttaagatgtgtatt
gtgctgtcttactgtggccaggctgcgtggattttagcgaataaacactcaggtattgaa
ctaaaccctttctttgctagtgtgccatcacaattaagggtttaccttgttagtttggca
accttggcagctattattgcctcacaggctcttatttcaggctcctttaccttggtttca
gaagccatgcgtttgaaaattttccctttgtttcgtgtgacttacccaggggcaaatttg
ggacaattgtatattcctgtcattaactggattttatttgcagtgacctcttgtactgtt
ttggcttttagaacatcagcccacatggaggcagcttatggtcttgctattaccatcacc
atgttgatgacaacaatcctcttaaagtattacttaatcaagaaaggaacgagacccatc
ttggctcatttagtgatggctttctttgcccttgtagaattcattttcttcttggcttca
gctatcaaatttatgcacggtggctatgcggttgttatcttggcacttgcaattgtcttt
gtcatgtttatctggcatgcgggcacacggattgttttcaagtatgtgaaatctcttaat
ttgaatgattacaaggagcagattaaacaacttcgtgacgacgtttgttttgacctctac
caaacaaatgttgtctacctatccaatcgtatgcaggatcatatgattgaccggtctatt
ttatactccattttagacaagcggccaaaacgcgctcaagtttattggtttgtaaatgtc
caggtaactgatgaaccttatacagctaagtacaaggtagatatggtgggaacggattat
atggttcgagtcaacctttatcttggttttagaatgccacagactgtgccacgctatttg
cgcacgattgttcaggatttgatggaaagtggccgtttacccaaacaagaacaggaatat
accatcacacctggtcgtgatgttggtgattttcgctttgttttaatagaagaacgggtc
tccaatgcacgtcaattgagtaactttgaacgctttattatgcacactaaggcaagcatt
aaacatgttaccgctagtccaatgcgttggtttgggcttcaatattcagaagtaactctt
gaagtggttcccttgattctatcagatatcttgaagttaccaatcaaagaattggtgcct
gtggaagacagtgaagcataa

DBGET integrated database retrieval system