KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1133cHelp
Entry
Spy49_1133c       CDS       T00780                                 

Gene name
prfC
Definition
(GenBank) Peptide chain release factor 3
  KO
K02837  
peptide chain release factor 3
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Translation factors [BR:soz03012]
 Prokaryotic Type
  Release factors
   Spy49_1133c (prfC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1127442..1128986)
Genome map
AA seq 514 aa AA seqDB search
MSLTEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKSGTFAKSDWMDIE
KQRGISVTSSVMQFDYAGKRVNILDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQT
KKLFEVVKHRNIPVFTFINKLDRDGREPLELLEELEEVLGIASYPMNWPIGMGRAFEGLY
DLHNKRLELYKGDERFASIEDGDQLFANNPFYEQVKEDIELLQEAGNDFSEQAILDGDLT
PVFFGSALTNFGVQTFLDTFLEFAPEPHGHKTTEGNVVDPLTKDFSGFVFKIQANMDPKH
RDRIAFVRIVSGEFERGMGVNLTRTGKGAKLSNVTQFMAESRENVTNAVAGDIIGVYDTG
TYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSPKNVMKQKSFHKGIEQLVQEGAIQLYKN
YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMTPMGKKTVRWISEDDLDQHMSSSRNIL
AKDRFDQPVFLFENDFALRWFADKYPDVTLEEKM
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttacagaagaaattaaaaaacgccgtacttttgccatcatctctcacccggat
gctggtaagacgactattactgagcaactattatattttggtggtgaaattagagaagca
gggacagtaaaagggaaaaaatcaggtacgtttgcaaagtccgactggatggatattgaa
aagcaacgtggtatctctgttacttcatctgttatgcaatttgattacgcgggtaaacgt
gttaatattttggatacacctggacatgaggatttctcggaagatacataccgtacctta
atggctgtggatgcggctgtcatggttgtagattcggctaaaggtattgaggcgcaaacg
aaaaaactttttgaagttgtcaaacatcgtaatattcctgtcttcacctttattaacaag
ttagaccgtgatgggcgtgagcctttagaactcttggaagaattagaagaagttttaggg
attgcttcttatccgatgaactggccgattggtatgggacgcgcctttgagggcttatat
gatttacataataaacgtttagaactctataagggagacgagcgttttgcaagtattgaa
gacggtgatcagttgtttgccaataatcccttttatgaacaagtcaaagaagatattgaa
cttcttcaagaagcaggtaatgacttttcagaacaagctattcttgatggtgacctaact
ccagtcttttttggctctgcccttacgaactttggagttcagacttttcttgatactttc
ttggagtttgccccagaacctcatggtcacaagactacagaaggtaatgttgttgacccc
ttaactaaagatttttcaggttttgtctttaaaattcaagctaacatggaccctaaacac
cgtgaccgtattgcttttgtgcgtattgtttctggtgaatttgagcgcggtatgggagtt
aatttgacacgcactggcaaaggcgctaagctctccaatgttactcaatttatggcagaa
tcacgggaaaatgtgacgaatgctgttgctggggatattatcggggtctatgatacagga
acttatcaagttggggataccttaacagttgggaaaaataaatttgaatttgaaccctta
ccaacttttaccccagaaatcttcatgaaggtttctccgaaaaatgttatgaagcagaaa
tccttccacaaaggtattgaacaattagtacaagaaggagcaattcagctttataagaat
tatcagacaggcgaatacatgctgggtgctgtgggtcaactgcagtttgaagtctttaaa
catcgtatggaaggtgaatacaacgctgaagttgtgatgacaccaatgggtaaaaagact
gttcgctggatttcagaagatgatttggatcaacacatgtcctcaagccgaaacatttta
gctaaggatcgttttgaccaaccagttttcctatttgaaaatgattttgcccttcgctgg
tttgcagacaaatacccagatgtcactttagaagagaaaatgtaa

DBGET integrated database retrieval system