KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1140cHelp
Entry
Spy49_1140c       CDS       T00780                                 

Gene name
fdhC
Definition
(GenBank) Formate/nitrite transporter family member
  KO
K21993  
formate transporter
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Transporters [BR:soz02000]
 Other Transporters
  Pores ion channels [TC:1]
   Spy49_1140c (fdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1134132..1134947)
Genome map
AA seq 271 aa AA seqDB search
MCVCEYSNKRRYHENPEQILEATIHIGEHKVTKTFLAKSILGFIGGAMISLGYLLYVRIA
ASGLETFGAFSSIVGACAFPIGLIIILMAGGELITGNMMAVSAALLAKKIKFSELAKNWL
IITLFNVIGAVFVAFVFGHFLGLTSAGIFKEEVIEVAHAKIAASPLQALVSGIGCNWFVG
LALWLCYGANDAAGKFLGTWFPVMTFVALGFQHSVANAFVIPAAIFEGGATWLDFATNFI
FVYSGNIIGGAIFVSFLYFKVYYHPQKSKTQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtttgtgaatacagtaacaaaaggagatatcatgaaaacccagaacagatttta
gaagcaactattcatattggggaacataaggttaccaaaacttttttggctaaatctatc
ttaggctttattggtggagcgatgattagccttggttatttactctacgtgagaattgcc
gccagtggtttagaaacttttggtgctttttccagtatcgtaggagcttgtgcttttccg
attggtctaattattattttaatggcgggtggagaattaattacagggaacatgatggct
gtttctgcagctttgttggccaaaaaaattaagtttagcgagcttgccaagaattggctt
atcattaccttgtttaatgtgattggagctgtttttgtagcttttgtgtttggtcatttt
ctaggcttgacatcagctggtatttttaaagaagaagtgattgaggtggcccatgctaaa
atagcagcgagccctttgcaggcactagtatcaggaattggttgtaactggtttgttggt
ttggccttgtggctatgctatggggcaaatgatgctgctggtaaattccttggtacttgg
tttcctgtcatgacctttgtagcccttggttttcagcatagtgtagcaaacgcttttgtc
attcctgctgctatttttgaaggaggagcaacatggttggattttgccactaattttatt
tttgtctatagtggtaatattatcggtggagccatttttgttagttttttatattttaaa
gtttactatcatccgcaaaagagtaaaactcaatga

DBGET integrated database retrieval system