KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1142cHelp
Entry
Spy49_1142c       CDS       T00780                                 

Definition
(GenBank) Transcriptional regulator, biotin repressor family
  KO
K07105  uncharacterized protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3H HTH_11 HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: ACI61430
UniProt: A0A0H3C190
Position
complement(1135737..1136258)
Genome map
AA seq 173 aa AA seqDB search
MKAEDRRQKIIECLNSEQKAVSATRLGKLLGVSRQVIVGDIALLRAQQIDIISTPKGYIM
STALYSHQFWARIVCQHNVEETKKELEIILAHQGIITTVEVEHPIYGMITAPLNIKTHSD
VTNFMSKLSQSKAELLSSLTEGLHSHLISCPSQEAFLAIKHDLELAGILYKGI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagaagatcgtcgtcaaaaaattattgagtgcttaaatagtgaacaaaaagct
gtatctgctactcgtttaggtaagttattaggagtgagtcgccaagtaatcgttggagat
atagctcttcttcgagctcagcagattgatattatttcgactcccaaagggtatattatg
tcaaccgcgctttatagtcaccaattttgggcacgtattgtgtgccaacataatgtagaa
gaaactaaaaaagaattagaaattattttagctcatcaagggattattacgacggtagag
gtagaacatcctatttacggtatgataacagcccctttaaatattaagacacactctgat
gtaactaatttcatgtccaaactcagtcaatctaaagcagagttattgtcttcgttgaca
gaaggactacatagtcacttaatttcgtgtcctagtcaagaagcctttttagctattaag
catgatttagaattagcaggtatcttatacaaaggaatataa

DBGET integrated database retrieval system