KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1143cHelp
Entry
Spy49_1143c       CDS       T00780                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00010  Glycolysis / Gluconeogenesis
soz00260  Glycine, serine and threonine metabolism
soz00680  Methane metabolism
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01120  Microbial metabolism in diverse environments
soz01130  Biosynthesis of antibiotics
soz01200  Carbon metabolism
soz01230  Biosynthesis of amino acids
Module
soz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
soz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spy49_1143c (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Spy49_1143c (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spy49_1143c (gpmA)
Enzymes [BR:soz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spy49_1143c (gpmA)
Membrane trafficking [BR:soz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Spy49_1143c (gpmA)
Exosome [BR:soz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spy49_1143c (gpmA)
  Exosomal proteins of melanoma cells
   Spy49_1143c (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACI61431
UniProt: B5XM69
Position
complement(1136365..1137060)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtattg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system