KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1149cHelp
Entry
Spy49_1149c       CDS       T00780                                 

Definition
(GenBank) Lipase/acylhydrolase
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1141671..1142513)
Genome map
AA seq 280 aa AA seqDB search
MNNRHLFSGIFFFVISLCLAFLLLNIIIPKSNSRLKKSDFLKKEQVAIQYVAIGDSLTEG
VGDLTHQGGFVPLLTNDLSEYFKANVNHQNYGVSGDTSQQILDRMIKQKQIQLSLKKADI
MTLTVGGNDVMAVIRKNLADLQVSSFRKPARQYQKRLRQIIELARKDNKDLPIFILGIYN
PFYLNFPELTDMQKVIDDWNTKTKEVVGEYDRVYFVPINDLLYKGINGQEGIVHSSGDQT
TIVNDALFTGDHFHPNNTGYQIMSNAVMEKIKKHEKKIKP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgtcatttatttagtgggatatttttctttgttattagtttatgtctggcc
tttttattgctaaatattattatccctaagtcaaattcacgtttgaaaaagagtgatttt
ctgaaaaaagaacaagtagctatccaatatgttgctataggagactcattgacagaagga
gtaggtgatctaactcatcaaggtggttttgttcctttgttaacgaatgatctcagtgaa
tattttaaggctaatgttaatcatcaaaattacggcgtatctggtgataccagtcaacaa
attcttgataggatgataaaacaaaagcagatacagttatctttaaaaaaagcagatata
atgacgttaaccgttggtggtaatgatgttatggcagttattcggaagaatttagcggat
ttgcaagtttctagttttagaaagccagctcgtcagtatcaaaaacgattaagacagatt
atcgagttagccagaaaagataataaagatcttcctatttttattttaggcatctataat
ccgttttatttgaattttccagaactaactgatatgcaaaaagtgattgatgactggaat
accaaaactaaggaggttgttggagaatacgatcgtgtgtactttgtgccaataaatgac
ctcttgtataaagggataaatggacaagaaggaattgtccattcttcaggagatcaaact
acaattgtcaatgatgccttgtttactggggaccattttcacccaaataatactggctat
caaatcatgtcaaatgcagtaatggagaaaataaaaaagcatgaaaaaaaaatcaaacct
taa

DBGET integrated database retrieval system