KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1154cHelp
Entry
Spy49_1154c       CDS       T00780                                 

Definition
(GenBank) Putative hemolysin
  KO
K06442  
23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Enzymes [BR:soz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     Spy49_1154c
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     Spy49_1154c
Ribosome biogenesis [BR:soz03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Spy49_1154c
   23S rRNA modification factors
    Spy49_1154c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1146840..1147667)
Genome map
AA seq 275 aa AA seqDB search
MPKERVDVLAYKQGLFETREQAKRGVMAGLVVSVINGQRYDKPGDKIDDGTELKLKGEKL
KYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVW
KLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIA
LIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHGNIEF
LAHLVKSQTPETLAPHLIQEVVAKAHKEFEKHEKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaaagagtagatgtgttagcctataagcaaggattatttgagaccagagag
caagctaagcgtggtgttatggcaggcttagtggtctctgtgattaatggccaacgctat
gacaagccaggtgacaaaattgacgatgggactgagttaaaacttaaaggtgaaaaactc
aaatacgtcagtcgtggtggattaaaactggaaaaggggctgcacgtttttggtgtatca
gttgctaatcaaattgggattgatattggcgcttcaacaggtggctttaccgatgttatg
ttacaagatggggccaaactagtctatgccgtcgacgttgggactaaccagttggtatgg
aaactcagacaagatccacgagtaagaagtatggaacagtataactttcgttatgctcag
ccagaggactttaatgagggacagcctgtatttgccagtattgatgtgtcctttatttct
ctcagcttgattttgccagccctgcataacgttttgtcagatcagggacaggttattgct
ctcattaaaccgcaatttgaagctgggcgcgagcagattggtaaaaaaggcatcgtcaaa
gacaaacagattcatgaaaaagtgattcaaaaggtcatggattttgcctcaggttacgga
tttacagttaagggacttgatttttcccctattcagggtggtcatggaaatatcgaattt
ttagctcatcttgttaagtcacagacacctgaaacgttagccccacatctgattcaggaa
gttgttgccaaggcacataaggagtttgagaaacatgaaaaaaagtga

DBGET integrated database retrieval system