KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1155cHelp
Entry
Spy49_1155c       CDS       T00780                                 

Gene name
fps
Definition
(GenBank) Octaprenyl-diphosphate synthase / Dimethylallyltransferase / Geranyltranstransferase / Geranylgeranyl pyrophosphate synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00900  Terpenoid backbone biosynthesis
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01130  Biosynthesis of antibiotics
Module
soz_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spy49_1155c (fps)
Enzymes [BR:soz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Spy49_1155c (fps)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Spy49_1155c (fps)
    2.5.1.29  geranylgeranyl diphosphate synthase
     Spy49_1155c (fps)
Prenyltransferases [BR:soz01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Spy49_1155c (fps)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ACI61443
UniProt: A0A0H3BZ09
Position
complement(1147867..1148532)
Genome map
AA seq 221 aa AA seqDB search
MDKLARIDEAIRRYYKTTSNGVSEELIDAILYSVDSGGKRIRPLILLEMIEGFGVSLQNA
HFDLAAALEMIHTGSLIHDDLPAMDNDDYRRGRLTNHKQFGEATAILAGDSLFLDPFGLI
AQAELNSEVKVALIQELSLASGTFGMVGGQMLDMKGENQALSLPQLSLIHLNKTGKLLTF
PFKAAALVTEQAITVRQQLEQAGMLIGHAFQIRDDILDVTA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattagctagaattgacgaagccattcgtcgctactataagacgactagtaac
ggtgtatctgaagagttgattgatgctatcttgtattctgttgacagtggtggcaagcgc
attcgaccacttatcttattagagatgattgagggatttggggtatcgttacagaatgct
cattttgatttggctgcagcccttgaaatgattcatacaggaagtctgattcacgatgat
ttgccagccatggataatgatgattaccgacgtggtagactgaccaatcacaaacaattt
ggagaagccacggccattttggcgggagatagcttatttttagacccctttgggttaata
gctcaagctgaattaaatagcgaggttaaagtagccttaatccaagaactttccctagct
tcaggaacttttggcatggttggtggtcagatgctagatatgaaaggggaaaatcaagct
ttgagtctccctcagttgtcactgattcacctcaataaaaccggaaaattattaactttt
ccttttaaagcagcagctcttgtaacagaacaggctattactgttcgtcaacaactagag
caggcgggaatgctcatcgggcacgcctttcagattagggatgatattttagacgtgaca
gcctag

DBGET integrated database retrieval system