KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1166Help
Entry
Spy49_1166        CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1159701..1160003
Genome map
AA seq 100 aa AA seqDB search
MRLINTTSSHPELIRNQLKNTDAYLVEVYSAGNTDVIFTQAPKHYELLISNKYRAIKEDE
LDIIREFFLKRKIDPKIVIPGQSKTLHTNNLIEISFQTSV
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatcaataccactagcagtcacccagaactcatcagaaatcagctaaaaaac
accgatgcctatttagtcgaagtatactcagcaggaaatacagatgtcatttttacccaa
gcaccaaaacattacgaactacttatttcaaataaataccgtgccatcaaggaggatgaa
cttgatatcattcgcgaattttttttaaaacgtaaaattgatcctaaaattgttattcct
ggacaatcaaaaacacttcacacgaataaccttattgaaatttcatttcaaacttctgta
taa

DBGET integrated database retrieval system