KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1175cHelp
Entry
Spy49_1175c       CDS       T00780                                 

Gene name
ftsQ
Definition
(GenBank) Cell division protein ftsQ
  KO
K03589  
cell division protein FtsQ
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Chromosome [BR:soz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Spy49_1175c (ftsQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1169420..1170568)
Genome map
AA seq 382 aa AA seqDB search
MAKDKEKQSDDKLVLTEWQKRNIEFLKKKKQQAEEEKKLKEKLLSDKKAQQQAQNASEAV
ELKTDEKTDSQEIESETTSKPKKTKKVRQPKEKSATQIAFQKSLPVLLGALLLMAVSIFM
ITPYSKKKEFSVRGNHQTNLDELIKASKVKASDYWLTLLISPGQYERPILRTIPWVKSVH
LSYQFPNHFLFNVIEFEIIAYAQVENGFQPILENGKRVDKVRASELPKSFLILNLKDEKA
IQQLVKQLTTLPKKLVKNIKSVSLANSKTTADLLLIEMHDGNVVRVPQSQLTLKLPYYQK
LKKNLENDSIVDMEVGIYTTTQEIENQPEVPLTPEQNAADKEGDKPGEHQEQTDNDSETP
ANQSSPQQAPPSPETVLEQAHG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagataaagagaaacaaagtgatgacaagctcgttttgacagagtggcaaaag
cgtaacattgaatttttaaagaaaaagaagcagcaagctgaggaagaaaaaaaactcaaa
gagaaattattgagtgataaaaaagcgcagcagcaagctcaaaatgcttctgaagcagtt
gagcttaaaactgatgagaaaactgatagtcaggaaattgagtcagaaacgacgtcaaaa
cctaaaaaaaccaaaaaagttagacaacccaaggaaaaaagtgcgacacaaatcgctttt
caaaaatccttgcctgttcttttgggggcgctcttactcatggcggtgtctatttttatg
atcactccttatagcaaaaagaaagagttttctgtaagaggaaaccatcaaacgaacctt
gacgaattaatcaaagctagcaaagtcaaagcatctgactattggttaacgttgttaatt
tcgcctggtcagtatgaacgaccgattcttcgtactattccatgggtgaaatctgtacat
ctctcttaccaatttcctaatcactttctatttaacgttattgaatttgaaatcatcgct
tatgcacaagtcgaaaacggttttcagcctattttggagaatggaaaacgtgtggataag
gtcagggcatcagaactaccgaaatctttcttgattcttaatttaaaagatgagaaagcg
atccaacagttagttaagcaattaacgacattacctaaaaaattagtcaagaatatcaag
tcagtgtctcttgcaaattccaaaacgacagcggatttactacttattgaaatgcatgac
ggtaatgtagttagagtaccgcagtcacaactcacattgaaacttccctattatcaaaaa
ttgaaaaaaaaccttgaaaatgatagtatagtggatatggaagttggaatttatactaca
acacaggagattgaaaatcaacctgaagttcctcttacgccagaacaaaacgcagctgat
aaagaaggagataagcctggtgaacatcaggaacagacagacaatgattcagaaacgcca
gcaaatcagagtagtcctcagcaagcaccaccatccccagaaacggtcctcgaacaggcc
catggctag

DBGET integrated database retrieval system