KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1176cHelp
Entry
Spy49_1176c       CDS       T00780                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spy49_1176c (murG)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Spy49_1176c (murG)
Enzymes [BR:soz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Spy49_1176c (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:soz01011]
 Precursor biosynthesis
  Glycosyltransferase
   Spy49_1176c (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1170569..1171651)
Genome map
AA seq 360 aa AA seqDB search
MPKKILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEIEKSGLDVTFHAIA
TGKLRRYFSWQNLADVFKVALGLLQSLFILAKLRPQALFSKGGFVSVPPVVAAKLLGKPV
FIHESDRSMGLANKIAYKFATTMYTTFEQEDQLSKVKHLGAVTKVFKDANQMPESTQLEA
VKEYFSRDLKTLLFIGGSAGAHVFNQFISDHPELKQRYNIINITGDPHLNELSSHLYRVD
YVTDLYQPLIAMADLVVTRGGSNTLFELLAMAKLHLIVPLGKEASRGDQLENATYFEKRG
YAKQLQEPDLTLHNFDQAMADLFEHQADYEATMLATKEIQSPDFFYDLLRADISSAIKEK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaagattttatttacaggtggtggaactgtaggtcatgtcaccttgaacctc
attctcataccaaaatttatcaaggacggttgggaagtacattatattggtgataaaaat
ggtattgaacatacagaaattgaaaagtcaggccttgacgtgacctttcatgctatcgcg
acaggcaagcttagacgctatttttcatggcaaaatctagctgatgtttttaaggttgca
cttggcctcctacagtctctctttattcttgccaagcttcgccctcaagcccttttttcc
aaaggtggttttgtctcagtaccgccagttgtggctgctaaattgcttggtaaaccagtc
tttattcatgaatcagatcggtcaatgggactagcaaacaagattgcctacaaatttgca
actaccatgtataccacttttgagcaggaagaccagttgtctaaagttaaacaccttgga
gcggtgacaaaggttttcaaagatgccaaccaaatgcctgaatcaactcagttagaggcg
gtgaaagagtattttagtagagacctaaaaaccctcttgtttattggtggttcggcaggg
gcgcatgtgtttaatcagtttattagtgatcatccagaattgaagcaacgttataatatc
atcaatattacaggagaccctcaccttaatgaattgagttctcatctgtatcgagtagat
tatgttaccgatctctatcaacctttgatagcgatggctgaccttgtagtgacaagaggg
ggctctaatacactttttgagctactggcaatggctaagctacacctcatcgttcctctt
ggtaaagaagctagccgtggcgatcagttagaaaatgccacttattttgagaagaggggc
tacgctaaacaattacaggaacctgatttaactttgcataattttgatcaggcaatggct
gatttgtttgaacatcaggctgattatgaggctactatgttggcaactaaggagattcag
tcaccggacttcttttatgaccttttgagagctgatattagctccgcgattaaggagaag
taa

DBGET integrated database retrieval system