KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1177cHelp
Entry
Spy49_1177c       CDS       T00780                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  
UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Spy49_1177c (murD)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spy49_1177c (murD)
Enzymes [BR:soz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Spy49_1177c (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:soz01011]
 Precursor biosynthesis
  Amino acid ligase
   Spy49_1177c (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1171651..1173009)
Genome map
AA seq 452 aa AA seqDB search
MKVISNFQNKKILILGLAKSGEAAAKLLTKLGALVTVNDSKPFDQNPAAQALLEEGIKVI
CGSHPVELLDEDFEYMVKNPGIPYDNPMVKRALAKEIPILTEVELAYFVSEAPIIGITGS
NGKTTTTTMIADVLNAGGQSALLSGNIGYPASKVVQKAIAGDTLVMELSSFQLVGVNAFR
PHIAVITNLMPTHLDYHGSFEDYVAAKWMIQAQMTESDYLILNANQEISATLAKTTKATV
IPFSTQKVVDGAYLKDGILYFKEQAIIAATDLGVPGSHNIENALATIAVAKLSGIADDII
AQCLSHFGGVKHRLQRVGQIKDITFYNDSKSTNILATQKALSGFDNSRLILIAGGLDRGN
EFDDLVPDLLGLKQMIILGESAERMKRAANKAEVSYLEARNVAEATELAFKLAQTGDTIL
LSPANASWDMYPNFEVRGDEFLATFDCLRGDA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgataagtaattttcaaaacaaaaaaatattaatattggggttagccaaatca
ggcgaagcagcagcaaaattattgactaaacttggtgctttagtgactgttaatgatagt
aaaccatttgaccaaaatccagcggcacaagccttgttggaagaggggattaaggtcatt
tgtggtagccacccagtagaattattagatgaggactttgagtacatggttaaaaaccct
gggattccttatgataatcctatggttaaacgcgcccttgcaaaggaaattcccatcttg
actgaagtagaattggcttatttcgtatctgaagcgcctattatcgggattacaggatca
aacgggaagacaaccacaacgacaatgattgccgatgttttgaatgctggcgggcaatct
gcactcttatctggaaacattggttatcctgcttcaaaagttgttcaaaaagcaattgct
ggtgatactttggtgatggaattgtcctcttttcaattagtgggagtgaatgcttttcgc
cctcatattgctgtcatcactaatttaatgccgactcatctggactatcatggcagtttt
gaggattatgttgctgctaaatggatgattcaagctcagatgacagaatcagactacctt
attttaaatgctaatcaagagatttcagcaactctagctaagaccaccaaagcaacagtg
attcctttttcaactcaaaaagttgttgatggagcttatctgaaggatggaatactctat
tttaaagaacaagcgattatagctgcaactgacttaggtgtcccaggtagccacaacatt
gaaaatgccctagcaactattgcagttgccaagttatctggtattgctgatgatattatt
gcccagtgcctttcacattttggaggtgttaaacatcgtttgcaacgggttggtcaaatc
aaagatattaccttctacaatgacagtaagtcaaccaatattttagccactcaaaaagct
ttatcaggttttgataacagtcgcttgattttgattgctggcggtctagatcgtggcaat
gaatttgacgatttggtgccagaccttttaggacttaagcagatgattattttgggagaa
tccgcagagcgtatgaagcgagctgctaacaaagcagaggtctcttatcttgaagctaga
aatgtggcagaagcaacagagcttgcttttaagctggcccaaacaggcgatactatcttg
cttagcccagccaatgctagctgggatatgtatcctaattttgaggttcgtggggatgaa
tttttggcaacctttgattgtttaagaggagatgcctaa

DBGET integrated database retrieval system