KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1189cHelp
Entry
Spy49_1189c       CDS       T00780                                 

Gene name
kdtB
Definition
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00770  Pantothenate and CoA biosynthesis
soz01100  Metabolic pathways
Module
soz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Spy49_1189c (kdtB)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Spy49_1189c (kdtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: ACI61477
UniProt: B5XMB5
Position
complement(1183511..1184002)
Genome map
AA seq 163 aa AA seqDB search
MLTKIGLYTGSFDPVTNGHLDIVKRASGLFDQIYVGIFDNPTKKSYFKLEVRKAMLTQAL
ADFTNVIVVTSHERLAIDVAKELRVTHLIRGLRNATDFEYEENLEYFNHLLAPNIETVYL
ISRNKWQALSSSRVRELIHFQSSLEGLVPQSVIAQVEKMNEKT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgttaactaaaataggactttatacagggtcatttgatcctgttacaaacggtcatctc
gatattgttaaacgggcaagtggcctatttgatcaaatatatgttgggatttttgataat
cctaccaaaaaaagctattttaaactagaagttcgtaaagcaatgcttactcaagctctg
gctgattttacaaatgtaattgtagtaacttcgcacgaacgtttagctattgatgtagct
aaagaattacgagtaactcacttgattagaggcttgcgaaatgcaactgactttgagtat
gaagaaaatttggaatattttaatcaccttttagctccaaatattgaaaccgtctatttg
atatcaagaaataaatggcaggcccttagctctagtcgtgtgagagagctaattcatttt
cagtcttccttagaaggtttggttcctcagtcggttattgctcaagtggagaaaatgaat
gaaaagacttaa

DBGET integrated database retrieval system