KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1192cHelp
Entry
Spy49_1192c       CDS       T00780                                 

Gene name
arcC
Definition
(GenBank) Carbamate kinase
  KO
K00926  
carbamate kinase [EC:2.7.2.2]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Arginine biosynthesis
Purine metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Spy49_1192c (arcC)
  Nucleotide metabolism
   00230 Purine metabolism
    Spy49_1192c (arcC)
  Amino acid metabolism
   00220 Arginine biosynthesis
    Spy49_1192c (arcC)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     Spy49_1192c (arcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1185959..1186909)
Genome map
AA seq 316 aa AA seqDB search
MTKQKIVVALGGNAILSTDASAKAQQEALISTSKSLVKLIKEGHEVIVTHGNGPQVGNLL
LQQAAADSEKNPAMPLDTCVAMTEGSIGFWLVNALDNELQAQGIQKEVAAVVTQVIVDAK
DPAFENPTKPIGPFLTEEDAKKQMAESGASFKEDAGRGWRKVVPSPKPVGIKEANVIRSL
VDSGVVVVSAGGGGVPVVEDATSKSLTGVEAVIDKDFASQTLSELVDADLFIVLTGVDNV
YINFNKPDQAKLEEVTVSQMKEYITQDQFAPGSMLPKVEAAIAFVENKPNAKAIITSLEN
IDNVLSANAGTQIIAG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacaaaaaatcgtagtcgcacttggaggaaatgctattctttcaacagatgcg
tcagcaaaagcacaacaagaagccttgatttccacatcaaaatcattggttaaattaatt
aaagaaggtcatgaagtcatcgtgacccacggcaatggcccacaagttggtaatctctta
ttacaacaagcagcggcagattctgaaaagaatccggctatgcctttggatacttgtgtt
gccatgacagaaggtagcattggtttttggttagtcaatgcccttgataatgaattgcaa
gcccaaggtattcaaaaagaagtggcagctgttgtcactcaagtgatcgtggatgccaaa
gacccagcttttgaaaacccaacaaaaccaattggtccatttcttaccgaagaagatgcc
aaaaaacaaatggcggagtctggtgcaagtttcaaagaagatgcaggtcgtggctggcgt
aaggttgtgccatcaccaaaaccagttggtattaaagaagccaatgtcatcagaagtctc
gttgattctggcgttgttgtggttagtgctggtggtggcggtgtgcctgttgtggaagat
gcaactagcaagtccctgactggtgtggaagctgttattgacaaggactttgctagccaa
accctttcagaattggtggatgcagacctctttatcgttttgacaggagttgacaatgtt
tacatcaacttcaacaaacctgaccaagccaaattggaagaagtgactgtctctcaaatg
aaagaatacatcacacaagaccaatttgcaccaggtagtatgttaccaaaagtggaagct
gccattgcttttgttgaaaacaaaccaaatgctaaagccattatcacatcgctagaaaat
attgacaatgtactatcagcaaacgctggaacacaaattatcgcaggataa

DBGET integrated database retrieval system