KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1202cHelp
Entry
Spy49_1202c       CDS       T00780                                 

Gene name
yesM
Definition
(GenBank) Putative two-component sensor histidine kinase
  KO
K07718  
two-component system, sensor histidine kinase YesM [EC:2.7.13.3]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Two-component system
Module
YesM-YesN two-component regulatory system
Brite
KEGG Orthology (KO) [BR:soz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spy49_1202c (yesM)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Spy49_1202c (yesM)
Protein kinases [BR:soz01001]
 Histidine kinases
  Other
   Spy49_1202c (yesM)
Two-component system [BR:soz02022]
 Other families
  YesM-YesN [MD:M00519]
   Spy49_1202c (yesM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1196372..1198105)
Genome map
AA seq 577 aa AA seqDB search
MKRYPLLVQLISYVFVIVIALITTLGLLYYQTSSRNIRQLIERDTRQSIRQSSQFIDAYI
KPLKETTSVLAKNSEIQDFASQIHQENDKQVLQLMKMVLATNSDLQAAVLVTKDGRTVST
NPQLIMKTSSDMMAEPWYKAAIDRQAMPILTPARQLSLSSKKEWVVSVTQEVVDAAGHNL
GVLRLDIAYPTIKASLDQLQLGRQGFAFIVNDKHEFVYHPKKSVYSSSKEMAAMKPYLAI
QNGYTKDKTSFVYQKLIPNSQWTLVGVASLDQLHRVQRQIFWSFLGTGLLACLICGFATV
LVLRRWIRPIQQLQQVILAIQKGDRQLRAQETGSPELTDLAQQFNALLDQIDSLMVAVAD
KEKAIGQYRLQALASQINPHFLYNTLDSIIWMAEFNDSKRVVEVTKSLAKYFRLALNQGN
EYIRLADELDHVSQYLFIQKQRYGDKLSYEVQGLDVYADFVIPKLILQPLVENAIYHGIK
EVDRKGMIKVTVSDTAQHLVLTVWDNGKGIEDSSLTNSQSLLTRGGVGLKNVDQRLKLHY
GEGYHMTIHSQSDQFTEIQLSLPKMHELMADDTQENE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttatcccctactggtccagttgatttcttatgtctttgtgatcgtaattgcc
ctcattaccacgcttggtttgctttattaccagacgagttctcgtaatatcaggcaatta
attgaacgtgatacccggcagagcattcggcaaagttcccaatttattgacgcttacatc
aagcctcttaaagaaacaacttcggtgctggcgaaaaattcggaaattcaagactttgct
agtcaaattcatcaagaaaatgacaaacaggttcttcagctcatgaagatggttcttgcg
accaattccgatttacaagcagctgttctggtgactaaggatggccgaaccgtttctacc
aatcctcagttgattatgaaaacctccagtgatatgatggcagaaccctggtataaagca
gccatagaccgtcaagccatgccaatcttaaccccagctcggcaattatccctttcttct
aaaaaagaatgggtagtttctgtgacccaagaggtagtggatgctgctggtcataattta
ggcgtgctaagacttgatattgcatacccgaccattaaagcgtctttagatcagcttcag
ctaggccgccaaggctttgcctttattgtgaatgataagcatgaatttgtttaccatccc
aaaaagagtgtttacagttcttctaaggagatggctgcgatgaagccttatttagcgatt
cagaatggttacactaaggacaagacatcttttgtttaccaaaaactcattcctaacagt
caatggactttagtgggagtggcgtcactggatcagttgcaccgggtgcagcgccaaatt
ttttggtcctttcttggaacagggcttctagcctgtctgatttgtggctttgcaactgtc
ttagtcttacgcagatggattcgtcccattcaacaattgcagcaagttattcttgctatt
caaaaaggagatcgtcagttacgtgcccaagaaacgggttctccagaattgacagacctt
gcccaacagtttaatgcgctcttagatcaaattgatagcttgatggttgccgttgcggat
aaggaaaaggcgattgggcagtacaggttacaagccttggctagtcagattaacccgcat
tttctctataacaccttggactctattatttggatggcagaatttaatgacagcaagcgc
gtggtagaagtgaccaagtctctagctaagtattttcgtttggcccttaatcaggggaac
gaatacattcgtttggcagatgaactggatcacgttagccaatacctttttattcaaaaa
cagcgctatggagacaagctaagttatgaagtgcaaggcttagatgtctacgcagacttt
gttattcctaagcttatcttacagcccttagtagaaaatgctatctaccatggcatcaaa
gaagtcgatcgcaaaggcatgatcaaggttacggtatctgatacagctcagcatctggtg
ttgactgtttgggataatggtaaaggcattgaagactcttcactgaccaatagtcagagc
ttgttgactaggggaggtgtgggccttaaaaatgttgaccagcggttaaaacttcactat
ggtgaaggctaccacatgaccattcatagccagtcagaccagttcactgaaatacaatta
agccttcctaaaatgcatgaattaatggcagacgacacacaggaaaacgagtaa

DBGET integrated database retrieval system