KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1205cHelp
Entry
Spy49_1205c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1200079..1200702)
Genome map
AA seq 207 aa AA seqDB search
MKKGLLVTTGLACLGLLTACSTQDNMAKKEITQDKMSMAAKKKDKMSTSKDKSMMADKSS
DKKMTNDGPMAPDFELKGIDGKTYRLSEFKGKKVYLKFWASWCSICLSTLADTEDLAKMS
DKDYVVLTVVSPGHQGEKSEADFKKWFQGTDYKDLPVLLDPDGKLLEAYGVRSYPTEVFI
GSDGVLAKKHIGYAKKSDIKKTLKGIH
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggactattagtaacaactggtttggcttgtctcgggctactaactgcttgc
tcaacccaagacaatatggctaaaaaggaaataactcaggacaagatgagcatggcagct
aaaaagaaagataagatgtcaacatcaaaggacaagtccatgatggcagataaatcatct
gataagaaaatgaccaatgatggtcctatggcgcctgatttcgaactcaaaggcatcgat
ggtaagacctatcgcttatcagagttcaaaggtaaaaaagtttatttgaaattttgggcc
tcttggtgttcaatctgtctatcaaccttggcagataccgaagacctggctaaaatgtca
gataaagactatgtggtcctaacagttgtctcgccaggtcatcaaggggaaaaatcagaa
gcagactttaaaaaatggttccaaggaacagactataaggacttaccagtcttgttagat
ccggatggcaagctattggaagcttacggcgtcagatcttacccaacagaagttttcatt
ggaagtgatggtgttcttgctaaaaaacacattggttatgccaaaaaatcagacatcaaa
aagacccttaaaggtatacattag

DBGET integrated database retrieval system