KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1220Help
Entry
Spy49_1220        CDS       T00780                                 

Gene name
aroA2
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spy49_1220 (aroA2)
Enzymes [BR:soz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Spy49_1220 (aroA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1215231..1215983
Genome map
AA seq 250 aa AA seqDB search
MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASF
QGLGLQGIRYLHEVCQEFGLLSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSH
IDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGVRGYDVETRNMLDIMAVPIIQ
QKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL
EQLGQELWQD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgattgacattatgtctgactttcaaaataagacttgttctaagaataattttattgtt
ggaccttgttccattgaatcttatgatcacattagattagcagcttcaagtgccaaaaaa
cttggttataactattttagaggaggcgcctataaaccaagaacatctgctgcttctttt
caaggccttggtctgcaaggaattcgttacttgcatgaggtttgtcaggaatttggctta
ctatcggtcagtgaaatcatgtccgagcgccaattagaagaagcctatgactatctcgat
gtcattcaggttggtgcccgcaacatgcaaaattttgaatttttaaaaaccttgtcacac
atcgataagcctattttgtttaaacgaggcttgatggctactatcgaggaatatttgggc
gccctttcctacttacaagacactggaaaatctaacattatcttatgcgaacgtggcgtt
cgtggctacgatgtggagactagaaatatgcttgatattatggcagtccctattattcaa
caaaagacagatttaccgattattgtggacgtgtctcattcgacaggcagacgagattta
ctcttacctgctgctaagatagcgaaggctgtcggtgccaatggcatcatgatggaggtt
catcctgatcccgaccatgcgctgtcagatgctgcccagcaaattgattataagcaatta
gaacagttggggcaggaactttggcaagattaa

DBGET integrated database retrieval system