KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1226cHelp
Entry
Spy49_1226c       CDS       T00780                                 

Definition
(RefSeq) beta-galactosidase (EC:3.2.1.23)
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spy49_1226c
  Lipid metabolism
   00600 Sphingolipid metabolism
    Spy49_1226c
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spy49_1226c
Enzymes [BR:soz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Spy49_1226c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1220252..1223668)
Genome map
AA seq 1138 aa AA seqDB search
MTSDSKEQTVTGYQYHYIDQEGRKQPFNQGWRFLMADVACAQDPSFDDSSWQVIHLPHDF
SLTQPYTRNGEAESAYKLGGVGWYRHYLVLDEVLAGCHVAITFEGSYMETEIYVNGQFIG
KHLNGYQEFTYDISDVVTFGAENLLAVRVENKVPSSRWYSGSGLYREVSLSVLPQLHFVA
DQVAMTLADTAVQEKGQQKVDLRFALNQSIQTCHYQLSLCLWEQSHCSKDKKLLYQETEV
PLADLAFQRQYGLTLSLEELQLWSPDNPHLYDLELTLYYQGQVIDCFCLETGFRQLTFTA
NQGLFVNGRAVKLKGVCLHHDQGGLGACAYEDALARQLVLLKDMGANTIRSTHNPSSPKL
RQLANRLGFFVIEEAFDTWTYAKNGNVNDFSNYFHQTIGTENASYLQRVRSPETSWAQYS
IEAMVWSAKNDPSVLMWSIGNELMEGFSADVSHYPELTRQMCQWITAIDTSRPITFGDNK
LKEADFCWHEEVSQMATLLSQLDHPQGLIGLNYANGKDYDKLHEEHSDWLLYGSETASAI
TSRAYYKETKKVLDSSYHLTSYDHAKVDWGAFASQAWYDTITRDFVAGECVWTGFDYLGE
PTPWNKIDSGVVGLWPSPKNAYFGILDTAGFPKDSYYFYQSQWAQGQTTLHLLPVWQKDQ
LCFDEQGLVEVVVYSNAASVQLMFEDEQGNLTDYGRKAFHTYSTPTGHTYQLYQGADAAK
NPHENLYLTWRVPYQKGLLRAVAYDISGKSIPKTSGRSQVRTYGSVAKLSWKAFEAPIDA
PWELLYLDLSLLDSRGELVSHAQDWLKVQVEGPARLLALDNGNPTDHTPYQEPLRQAYGG
KLLAILALTGEAGHIKVTAKASQQLSSVFQTQVACRAPKEHLVTLPLEKYQFKKSRLTSQ
QEIGQSCLKTTQFLSVLENKDTQQKAGKASTPHILITSYQHYLPLPLQVCSQAFDFKKGD
DIFLPQWLQVKDAQGSFVKKAFSMTWYLKEKIFAKPILVTGYVSCFGQSIPVEARLNLAQ
ASKRRHQDLSLVAKQSLAASQKRLTYCYQYDTVQAIGAISLQNHTGTSLSVSVAISYGSQ
SSIKQETLMLADSHLSQLEEVIFFDDILTVLYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagatagcaaggagcagacagtgactggctaccaataccactatattgatcaa
gaaggaagaaagcagccctttaatcaaggctggcgttttcttatggcagatgtggcgtgt
gctcaggacccttcttttgatgattcgagctggcaggtgattcatttaccacatgatttc
agtcttacgcagccttacacaagaaatggtgaagctgaaagtgcttataaattaggtggt
gtcggttggtatcggcattatctcgtgttagatgaggttttagctggttgtcatgttgcc
attacttttgagggttcctatatggaaacggaaatttatgttaatgggcaattcattggc
aaacacttaaatggctatcaggaatttacctatgatatctctgatgttgtgacttttgga
gctgaaaatcttctggctgttcgggttgaaaacaaggttcccagttctcgttggtattca
ggcagtggtctttatcgtgaagtgagtttgtctgttcttccccagcttcattttgtggca
gaccaggtagcaatgaccttggctgatactgctgtgcaggagaaagggcaacagaaagtt
gatttacgctttgcccttaatcagtctattcagacttgccactaccaattgagcctctgt
ttatgggaacaatcacattgctcaaaagacaagaaactcctttatcaagaaacagaagtg
cctctagctgatttggctttccaaagacagtatggtcttacactgtctttggaagaactc
caattgtggtcaccagataatcctcacctctacgatttagaactcactctttactatcaa
ggtcaggtcattgattgcttttgccttgaaactggttttcgtcagctgacttttacggcc
aatcaggggctttttgtgaatggcagagctgtcaaattaaagggagtttgtttgcatcat
gaccaaggaggcctaggagcttgtgcttacgaagatgccctagccagacaattagtcctg
ttgaaagacatgggggctaataccattcgtagcacccataacccaagtagtcccaaactt
aggcaactagccaatcgtctcggcttttttgtgattgaagaagcctttgacacctggacc
tatgccaaaaatggaaatgttaatgacttttcaaactatttccatcagactatcggaact
gaaaatgcaagctatcttcaaagagtgaggtcacctgaaacgagctgggcccagtatagt
attgaggccatggtctggtctgccaagaatgacccgtcagtgttgatgtggtcgattggt
aatgaattgatggaaggtttttcagccgatgtcagtcattacccagagctgacaagacaa
atgtgccaatggattactgctattgacacctcacgtcccattacctttggggacaataaa
ttaaaagaagctgacttttgctggcatgaggaagtgtcgcaaatggcaactcttcttagt
caattagaccatccccagggactcattgggttaaactatgctaatggaaaagactatgat
aagcttcatgaggagcactctgattggctgttgtatggttctgaaacagcctcagccatt
accagcagggcttattataaagagacaaaaaaagttcttgattccagttatcacctaacc
tcttatgatcatgctaaggttgattggggtgccttcgctagccaggcttggtatgatacc
attacccgtgattttgttgctggcgaatgcgtttggacaggatttgattatttaggagaa
cctacaccctggaacaagatcgacagcggtgttgtaggcctttggccttctcctaaaaat
gcctactttggcattttagacacggcaggctttccaaaagatagctattatttttaccaa
agtcagtgggcgcaggggcagaccaccttgcacctgttaccagtctggcagaaggaccag
ctttgtttcgatgagcagggattggtggaggttgtggtttatagcaatgctgccagtgtg
caactgatgtttgaagatgagcagggcaacttaacagattatggaaggaaggcatttcat
acttatagcacgccaacgggacacacttatcagctttaccaaggagctgacgctgctaag
aatcctcacgagaatctttacctgacttggcgagtgccctatcaaaaagggttgctaagg
gcagtggcctacgacatttctggtaaaagcattccaaaaaccagtggacgttctcaggtt
agaacctatggttcagtggcaaagctatcttggaaagcctttgaagcacctattgacgct
ccttgggaattgctttatctggatttatcactcttggatagccgaggtgaattggtcagc
catgctcaagattggctaaaggttcaagtagaaggaccagcccgtttgttggctcttgat
aatgggaatccgactgaccacaccccttatcaggagcctctacgccaggcatatggggga
aaattattagccattttagccctcactggagaggcgggacacattaaggtcacggcaaaa
gcctcgcagcaacttagcagtgtttttcagacacaagtagcctgccgtgcccccaaagaa
cacttagtgacactacctttagagaaatatcagtttaaaaagagccgactgacaagtcaa
caagaaattggtcaatcttgtctaaagaccacacaattcctttctgttttggagaacaaa
gacacccagcaaaaagcaggtaaggctagcacacctcacattcttatcaccagttaccag
cactatttacctctgcccttgcaggtttgttctcaggcatttgattttaaaaaaggcgat
gatatcttcttgcctcagtggctccaagtcaaagatgcccaaggttcttttgtgaaaaaa
gctttttcaatgacgtggtacctaaaagagaaaatctttgccaagcctattcttgtcacg
ggctatgtttcttgttttgggcaatcaataccggttgaggcaaggctcaacctagcacaa
gctagcaaaagacggcaccaggatctcagtttagtcgccaagcaatccctggccgcaagt
caaaaaaggctaacttattgctaccaatatgatacggtgcaagccataggagccattagc
ttgcaaaatcacacaggcacatctcttagtgtttctgtggcaatcagttatggtagtcag
agctctattaagcaagaaaccttgatgctagctgatagccacttgagccagttagaagag
gttattttcttcgatgatattttgactgttttgtatctggcagtgacccttgaagtcatt
gaaggacctgacctaactgaagacagtattcaaattggcctttgggatttagcatga

DBGET integrated database retrieval system