KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1226cHelp
Entry
Spy49_1226c       CDS       T00780                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:soz00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:soz00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1220252..1223668)
Genome map
AA seq 1138 aa AA seqDB search
MTSDSKEQTVTGYQYHYIDQEGRKQPFNQGWRFLMADVACAQDPSFDDSSWQVIHLPHDF
SLTQPYTRNGEAESAYKLGGVGWYRHYLVLDEVLAGCHVAITFEGSYMETEIYVNGQFIG
KHLNGYQEFTYDISDVVTFGAENLLAVRVENKVPSSRWYSGSGLYREVSLSVLPQLHFVA
DQVAMTLADTAVQEKGQQKVDLRFALNQSIQTCHYQLSLCLWEQSHCSKDKKLLYQETEV
PLADLAFQRQYGLTLSLEELQLWSPDNPHLYDLELTLYYQGQVIDCFCLETGFRQLTFTA
NQGLFVNGRAVKLKGVCLHHDQGGLGACAYEDALARQLVLLKDMGANTIRSTHNPSSPKL
RQLANRLGFFVIEEAFDTWTYAKNGNVNDFSNYFHQTIGTENASYLQRVRSPETSWAQYS
IEAMVWSAKNDPSVLMWSIGNELMEGFSADVSHYPELTRQMCQWITAIDTSRPITFGDNK
LKEADFCWHEEVSQMATLLSQLDHPQGLIGLNYANGKDYDKLHEEHSDWLLYGSETASAI
TSRAYYKETKKVLDSSYHLTSYDHAKVDWGAFASQAWYDTITRDFVAGECVWTGFDYLGE
PTPWNKIDSGVVGLWPSPKNAYFGILDTAGFPKDSYYFYQSQWAQGQTTLHLLPVWQKDQ
LCFDEQGLVEVVVYSNAASVQLMFEDEQGNLTDYGRKAFHTYSTPTGHTYQLYQGADAAK
NPHENLYLTWRVPYQKGLLRAVAYDISGKSIPKTSGRSQVRTYGSVAKLSWKAFEAPIDA
PWELLYLDLSLLDSRGELVSHAQDWLKVQVEGPARLLALDNGNPTDHTPYQEPLRQAYGG
KLLAILALTGEAGHIKVTAKASQQLSSVFQTQVACRAPKEHLVTLPLEKYQFKKSRLTSQ
QEIGQSCLKTTQFLSVLENKDTQQKAGKASTPHILITSYQHYLPLPLQVCSQAFDFKKGD
DIFLPQWLQVKDAQGSFVKKAFSMTWYLKEKIFAKPILVTGYVSCFGQSIPVEARLNLAQ
ASKRRHQDLSLVAKQSLAASQKRLTYCYQYDTVQAIGAISLQNHTGTSLSVSVAISYGSQ
SSIKQETLMLADSHLSQLEEVIFFDDILTVLYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagatagcaaggagcagacagtgactggctaccaataccactatattgatcaa
gaaggaagaaagcagccctttaatcaaggctggcgttttcttatggcagatgtggcgtgt
gctcaggacccttcttttgatgattcgagctggcaggtgattcatttaccacatgatttc
agtcttacgcagccttacacaagaaatggtgaagctgaaagtgcttataaattaggtggt
gtcggttggtatcggcattatctcgtgttagatgaggttttagctggttgtcatgttgcc
attacttttgagggttcctatatggaaacggaaatttatgttaatgggcaattcattggc
aaacacttaaatggctatcaggaatttacctatgatatctctgatgttgtgacttttgga
gctgaaaatcttctggctgttcgggttgaaaacaaggttcccagttctcgttggtattca
ggcagtggtctttatcgtgaagtgagtttgtctgttcttccccagcttcattttgtggca
gaccaggtagcaatgaccttggctgatactgctgtgcaggagaaagggcaacagaaagtt
gatttacgctttgcccttaatcagtctattcagacttgccactaccaattgagcctctgt
ttatgggaacaatcacattgctcaaaagacaagaaactcctttatcaagaaacagaagtg
cctctagctgatttggctttccaaagacagtatggtcttacactgtctttggaagaactc
caattgtggtcaccagataatcctcacctctacgatttagaactcactctttactatcaa
ggtcaggtcattgattgcttttgccttgaaactggttttcgtcagctgacttttacggcc
aatcaggggctttttgtgaatggcagagctgtcaaattaaagggagtttgtttgcatcat
gaccaaggaggcctaggagcttgtgcttacgaagatgccctagccagacaattagtcctg
ttgaaagacatgggggctaataccattcgtagcacccataacccaagtagtcccaaactt
aggcaactagccaatcgtctcggcttttttgtgattgaagaagcctttgacacctggacc
tatgccaaaaatggaaatgttaatgacttttcaaactatttccatcagactatcggaact
gaaaatgcaagctatcttcaaagagtgaggtcacctgaaacgagctgggcccagtatagt
attgaggccatggtctggtctgccaagaatgacccgtcagtgttgatgtggtcgattggt
aatgaattgatggaaggtttttcagccgatgtcagtcattacccagagctgacaagacaa
atgtgccaatggattactgctattgacacctcacgtcccattacctttggggacaataaa
ttaaaagaagctgacttttgctggcatgaggaagtgtcgcaaatggcaactcttcttagt
caattagaccatccccagggactcattgggttaaactatgctaatggaaaagactatgat
aagcttcatgaggagcactctgattggctgttgtatggttctgaaacagcctcagccatt
accagcagggcttattataaagagacaaaaaaagttcttgattccagttatcacctaacc
tcttatgatcatgctaaggttgattggggtgccttcgctagccaggcttggtatgatacc
attacccgtgattttgttgctggcgaatgcgtttggacaggatttgattatttaggagaa
cctacaccctggaacaagatcgacagcggtgttgtaggcctttggccttctcctaaaaat
gcctactttggcattttagacacggcaggctttccaaaagatagctattatttttaccaa
agtcagtgggcgcaggggcagaccaccttgcacctgttaccagtctggcagaaggaccag
ctttgtttcgatgagcagggattggtggaggttgtggtttatagcaatgctgccagtgtg
caactgatgtttgaagatgagcagggcaacttaacagattatggaaggaaggcatttcat
acttatagcacgccaacgggacacacttatcagctttaccaaggagctgacgctgctaag
aatcctcacgagaatctttacctgacttggcgagtgccctatcaaaaagggttgctaagg
gcagtggcctacgacatttctggtaaaagcattccaaaaaccagtggacgttctcaggtt
agaacctatggttcagtggcaaagctatcttggaaagcctttgaagcacctattgacgct
ccttgggaattgctttatctggatttatcactcttggatagccgaggtgaattggtcagc
catgctcaagattggctaaaggttcaagtagaaggaccagcccgtttgttggctcttgat
aatgggaatccgactgaccacaccccttatcaggagcctctacgccaggcatatggggga
aaattattagccattttagccctcactggagaggcgggacacattaaggtcacggcaaaa
gcctcgcagcaacttagcagtgtttttcagacacaagtagcctgccgtgcccccaaagaa
cacttagtgacactacctttagagaaatatcagtttaaaaagagccgactgacaagtcaa
caagaaattggtcaatcttgtctaaagaccacacaattcctttctgttttggagaacaaa
gacacccagcaaaaagcaggtaaggctagcacacctcacattcttatcaccagttaccag
cactatttacctctgcccttgcaggtttgttctcaggcatttgattttaaaaaaggcgat
gatatcttcttgcctcagtggctccaagtcaaagatgcccaaggttcttttgtgaaaaaa
gctttttcaatgacgtggtacctaaaagagaaaatctttgccaagcctattcttgtcacg
ggctatgtttcttgttttgggcaatcaataccggttgaggcaaggctcaacctagcacaa
gctagcaaaagacggcaccaggatctcagtttagtcgccaagcaatccctggccgcaagt
caaaaaaggctaacttattgctaccaatatgatacggtgcaagccataggagccattagc
ttgcaaaatcacacaggcacatctcttagtgtttctgtggcaatcagttatggtagtcag
agctctattaagcaagaaaccttgatgctagctgatagccacttgagccagttagaagag
gttattttcttcgatgatattttgactgttttgtatctggcagtgacccttgaagtcatt
gaaggacctgacctaactgaagacagtattcaaattggcctttgggatttagcatga

DBGET integrated database retrieval system