KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1227cHelp
Entry
Spy49_1227c       CDS       T00780                                 

Definition
(GenBank) Putative two-component sensor response regulator
  KO
K07720  
two-component system, response regulator YesN
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
Two-component system
Module
YesM-YesN two-component regulatory system
Brite
KEGG Orthology (KO) [BR:soz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spy49_1227c
Two-component system [BR:soz02022]
 Other families
  YesM-YesN [MD:M00519]
   Spy49_1227c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1223688..1225172)
Genome map
AA seq 494 aa AA seqDB search
MYKVLLVDDEYMILQGLTMIIDWQALGFEVVQTARSGKEALAYLTQYPVDVMISDVTMPG
MTGLDLIEAAKTYHPQLQTLILSGYQEFSYVQKAMELETKGYLLKPVDKAELQAKMKQFK
DCLDVQQAESIRQEAYHDSLLTLWLTDELSEKEFQQLSQGLPAAALTGFTVLYLDCQEWQ
AAIDAYFEREGQPFYLKKEEDKKVYLAVLLGKTDQAKAFTYDLQKRFSRNMHQLILGETV
DDWENVYESYNQVLKSLFYNCEVSPIRAKDKSKIELPESRLQFFAFNKALMIGDEPTILS
KLEAIFDEMKTLNFSPEDVKHVSFLLFSDIYRQFPILDKMTYLSMVKTIHDSQSIDRILR
ELKKVLDVTNQNNSPEKRYSDLVSETIDCIRKEYHQELTLKAIADRLHVNGVYLGQCFKN
ETERSFTQYLNHVRIQKAQQLLLYTNQSINEIAYETGYNTNHYFIKMFKKLNGLSPKEFR
DRYKDNYQAIKGDQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtataaggtactattagttgacgatgaatacatgattttacaagggctcaccatgatt
attgattggcaggcacttggatttgaagtggttcaaacagcaagatcaggcaaggaagcc
ttagcctatttgactcagtacccagtggatgtcatgatttcagatgttaccatgcctgga
atgacaggactggatttaatagaagcagctaaaacctatcatcctcagctacaaaccttg
attttatctggttatcaagaattctcctatgtgcaaaaggctatggaattagaaaccaag
gggtatttgctaaaacctgtggataaggcagaattacaggctaaaatgaaacaatttaaa
gactgcttggatgtccagcaggcagaatcaatccggcaagaagcctatcatgacagcctt
ttgaccctttggcttacagatgaattgagtgagaaagaatttcagcagctaagtcaaggc
ttgccagcggctgctttaactggttttacagtgctatatttggactgtcaagagtggcaa
gcagccatcgatgcttattttgaacgagaaggtcagcctttttacctcaaaaaagaagaa
gataagaaggtttatctggctgtcctacttggtaaaactgatcaagccaaggcatttacc
tatgatctacaaaagcgattctcaagaaacatgcatcaacttattttgggagaaacagtt
gatgactgggaaaatgtttatgaaagctacaatcaggtgcttaagagcctcttttacaat
tgtgaagtgtcaccaattagagcaaaagataagtccaaaattgaactaccagagtcccgt
ttgcagttctttgcttttaacaaggcgttgatgattggggacgaacctacaatcttgtct
aaattagaagctatttttgacgagatgaagaccttgaacttttcaccagaggatgtgaag
catgtttcgttcttgttgttttctgacatttaccgtcaatttcccattttagataaaatg
acttatctgtccatggtaaaaactattcatgacagccaatccattgatcgcattttgagg
gaactaaaaaaagtgttggatgtcaccaatcagaacaattcccctgaaaaacgctattca
gatttagttagtgaaaccattgattgcattcgcaaggaataccatcaagaattaaccctt
aaagctatcgctgataggttacatgtcaatggggtttatttagggcaatgctttaaaaat
gaaaccgagcgtagttttacccagtacttaaatcatgtcaggattcaaaaagcgcaacag
ttattgctttacaccaaccaatccatcaatgaaattgcttatgaaacaggttacaatacc
aatcattattttatcaagatgtttaaaaagttgaatggtttatcgccaaaagagttcaga
gatcgttacaaggacaattaccaagccatcaagggtgaccagtaa

DBGET integrated database retrieval system